Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9MAV1

Protein Details
Accession A0A0C9MAV1    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-27SSTPKGTIRKRVTSRSNNNNAARHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 6, cyto_nucl 2, pero 2, golg 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR030671  Sec61-beta/Sbh  
IPR016482  SecG/Sec61-beta/Sbh  
Gene Ontology GO:0005784  C:Sec61 translocon complex  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF03911  Sec61_beta  
Amino Acid Sequences MQADSSTPKGTIRKRVTSRSNNNNAARGGIPGGSTSSMMRIYSDDSPGLRVDPVVVLVLSLTFIASVFGLHIVGRFLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.74
4 0.77
5 0.81
6 0.81
7 0.82
8 0.81
9 0.77
10 0.71
11 0.61
12 0.52
13 0.42
14 0.32
15 0.24
16 0.15
17 0.13
18 0.09
19 0.09
20 0.07
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.09
29 0.1
30 0.11
31 0.11
32 0.1
33 0.12
34 0.12
35 0.12
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.03
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.06