Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9LXQ5

Protein Details
Accession A0A0C9LXQ5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-73DVVMSFRKTKDRKKEKEKEKKTFNPFALHydrophilic
NLS Segment(s)
PositionSequence
52-66RKTKDRKKEKEKEKK
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0045947  P:negative regulation of translational initiation  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MAVDQGNRVNYDRTTLLALAGSQFAKAPPVKMAFIPGVTRTPNQSDVVMSFRKTKDRKKEKEKEKKTFNPFALLGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.14
5 0.14
6 0.11
7 0.12
8 0.1
9 0.08
10 0.08
11 0.08
12 0.11
13 0.12
14 0.12
15 0.13
16 0.16
17 0.16
18 0.16
19 0.19
20 0.15
21 0.16
22 0.15
23 0.13
24 0.13
25 0.13
26 0.14
27 0.13
28 0.15
29 0.17
30 0.17
31 0.16
32 0.14
33 0.14
34 0.18
35 0.18
36 0.17
37 0.2
38 0.2
39 0.29
40 0.35
41 0.43
42 0.5
43 0.59
44 0.69
45 0.75
46 0.84
47 0.86
48 0.92
49 0.93
50 0.92
51 0.92
52 0.92
53 0.9
54 0.88
55 0.79
56 0.74
57 0.64
58 0.56