Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9M7D5

Protein Details
Accession A0A0C9M7D5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-77HWFRLKTDTKIRWNAKRRNWRHTKLNIHydrophilic
NLS Segment(s)
PositionSequence
38-71KLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWR
Subcellular Location(s) nucl 16, mito_nucl 13.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MWGVRLHKKQDLAHKCLLLSLDQNTEMPSQKSFITKVKLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWRHTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.5
3 0.45
4 0.4
5 0.31
6 0.25
7 0.2
8 0.17
9 0.16
10 0.16
11 0.16
12 0.17
13 0.17
14 0.16
15 0.14
16 0.13
17 0.13
18 0.15
19 0.16
20 0.19
21 0.21
22 0.23
23 0.27
24 0.33
25 0.38
26 0.39
27 0.45
28 0.51
29 0.57
30 0.63
31 0.69
32 0.69
33 0.7
34 0.76
35 0.77
36 0.76
37 0.74
38 0.74
39 0.66
40 0.64
41 0.64
42 0.62
43 0.58
44 0.59
45 0.59
46 0.58
47 0.67
48 0.7
49 0.73
50 0.77
51 0.8
52 0.81
53 0.84
54 0.83
55 0.84
56 0.87
57 0.85