Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MFT4

Protein Details
Accession A0A0C9MFT4   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
20-66VFPRCHCQHKKPGGSKPDKKKKPAAPKKPVDKKKKKKEEEQKKKALABasic
NLS Segment(s)
PositionSequence
29-77KKPGGSKPDKKKKPAAPKKPVDKKKKKKEEEQKKKALALAKEKEDRKRV
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MPMKLVIYNVNANGPFCNHVFPRCHCQHKKPGGSKPDKKKKPAAPKKPVDKKKKKKEEEQKKKALALAKEKEDRKRVVPTFWNPRKPSKGVFEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.16
4 0.2
5 0.17
6 0.22
7 0.26
8 0.29
9 0.37
10 0.42
11 0.52
12 0.53
13 0.6
14 0.66
15 0.7
16 0.76
17 0.75
18 0.76
19 0.76
20 0.8
21 0.82
22 0.83
23 0.84
24 0.81
25 0.78
26 0.79
27 0.78
28 0.79
29 0.8
30 0.8
31 0.79
32 0.81
33 0.86
34 0.87
35 0.88
36 0.88
37 0.88
38 0.88
39 0.89
40 0.91
41 0.88
42 0.88
43 0.9
44 0.9
45 0.9
46 0.89
47 0.87
48 0.8
49 0.74
50 0.67
51 0.62
52 0.56
53 0.54
54 0.5
55 0.48
56 0.52
57 0.55
58 0.59
59 0.59
60 0.57
61 0.52
62 0.56
63 0.51
64 0.52
65 0.56
66 0.58
67 0.63
68 0.69
69 0.74
70 0.68
71 0.75
72 0.75
73 0.71
74 0.68