Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MKW6

Protein Details
Accession A0A0C9MKW6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-116DNDSIKNTKNIHRKKRAHKHTGGCCGGNHydrophilic
NLS Segment(s)
PositionSequence
101-105RKKRA
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MSISPSKQAAIHAYRHLLKTQKQVFGAARKETYSRFMQFKDETNTDVLEEKLQLAGQVETLLKKNVIQGVPQGNNTFKLRITEDTELGDNDSIKNTKNIHRKKRAHKHTGGCCGGNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.4
5 0.41
6 0.47
7 0.49
8 0.49
9 0.46
10 0.49
11 0.49
12 0.51
13 0.51
14 0.44
15 0.39
16 0.35
17 0.36
18 0.33
19 0.32
20 0.29
21 0.28
22 0.28
23 0.27
24 0.32
25 0.31
26 0.35
27 0.36
28 0.32
29 0.3
30 0.27
31 0.26
32 0.21
33 0.2
34 0.16
35 0.1
36 0.09
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.05
44 0.06
45 0.06
46 0.07
47 0.08
48 0.08
49 0.07
50 0.08
51 0.09
52 0.13
53 0.13
54 0.12
55 0.16
56 0.22
57 0.23
58 0.25
59 0.25
60 0.21
61 0.24
62 0.25
63 0.22
64 0.16
65 0.17
66 0.18
67 0.2
68 0.25
69 0.24
70 0.24
71 0.24
72 0.25
73 0.22
74 0.21
75 0.18
76 0.13
77 0.11
78 0.13
79 0.12
80 0.13
81 0.17
82 0.2
83 0.27
84 0.38
85 0.48
86 0.56
87 0.66
88 0.75
89 0.82
90 0.89
91 0.92
92 0.92
93 0.91
94 0.9
95 0.89
96 0.89
97 0.83