Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9N352

Protein Details
Accession A0A0C9N352    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-71NSEVPGKKRTKKDRACDLCRRKKIRQITNYGNEKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MYPHHLPNPQQHLSQQQQQQLPPLQLSLPPPLPPPNNSEVPGKKRTKKDRACDLCRRKKIRQITNYGNEKTRTINID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.48
4 0.48
5 0.47
6 0.5
7 0.45
8 0.41
9 0.33
10 0.28
11 0.22
12 0.2
13 0.21
14 0.19
15 0.17
16 0.16
17 0.18
18 0.22
19 0.23
20 0.23
21 0.25
22 0.25
23 0.26
24 0.27
25 0.31
26 0.31
27 0.35
28 0.43
29 0.45
30 0.48
31 0.55
32 0.63
33 0.68
34 0.72
35 0.76
36 0.78
37 0.81
38 0.83
39 0.85
40 0.86
41 0.85
42 0.86
43 0.85
44 0.81
45 0.8
46 0.81
47 0.81
48 0.79
49 0.78
50 0.78
51 0.81
52 0.82
53 0.77
54 0.72
55 0.64
56 0.56
57 0.5