Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9LWU8

Protein Details
Accession A0A0C9LWU8   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKSAKFYKRPSKKEKEGLAIKKLHydrophilic
73-96QSLNATQKNKKEKKEKEPELPDYVHydrophilic
NLS Segment(s)
PositionSequence
8-39YKRPSKKEKEGLAIKKLIEPTAITKKGGKETK
102-113KKTFKKIPKKRK
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 10.5
Family & Domain DBs
Amino Acid Sequences MGKSAKFYKRPSKKEKEGLAIKKLIEPTAITKKGGKETKKIHVPASMFADNKNKDVAPPPAAVDQDVEMDVDQSLNATQKNKKEKKEKEPELPDYVDLFSGKKTFKKIPKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.84
5 0.81
6 0.77
7 0.7
8 0.6
9 0.54
10 0.48
11 0.39
12 0.29
13 0.23
14 0.24
15 0.3
16 0.31
17 0.28
18 0.3
19 0.32
20 0.4
21 0.46
22 0.42
23 0.41
24 0.45
25 0.53
26 0.58
27 0.57
28 0.5
29 0.48
30 0.46
31 0.4
32 0.41
33 0.35
34 0.27
35 0.27
36 0.33
37 0.28
38 0.28
39 0.26
40 0.2
41 0.17
42 0.2
43 0.22
44 0.17
45 0.16
46 0.17
47 0.18
48 0.18
49 0.17
50 0.14
51 0.12
52 0.09
53 0.09
54 0.08
55 0.05
56 0.06
57 0.06
58 0.05
59 0.04
60 0.04
61 0.04
62 0.06
63 0.08
64 0.11
65 0.16
66 0.24
67 0.35
68 0.42
69 0.5
70 0.6
71 0.68
72 0.75
73 0.82
74 0.83
75 0.83
76 0.84
77 0.81
78 0.76
79 0.68
80 0.59
81 0.49
82 0.41
83 0.32
84 0.24
85 0.18
86 0.15
87 0.17
88 0.19
89 0.21
90 0.27
91 0.35
92 0.44
93 0.55