Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MM49

Protein Details
Accession A0A0C9MM49   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-35TKTANERQQQQQKRTPNKRQDTKECITHydrophilic
66-90RESIAKTASKRQPQQQRLPKHQDNKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MLAAAADITKTANERQQQQQKRTPNKRQDTKECITKTVIINEQQQQQQQTAPRQQVNASIHVKLPRESIAKTASKRQPQQQRLPKHQDNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.38
3 0.48
4 0.56
5 0.62
6 0.68
7 0.72
8 0.79
9 0.83
10 0.84
11 0.84
12 0.85
13 0.87
14 0.87
15 0.86
16 0.84
17 0.79
18 0.77
19 0.68
20 0.59
21 0.51
22 0.46
23 0.38
24 0.34
25 0.32
26 0.26
27 0.28
28 0.29
29 0.32
30 0.3
31 0.3
32 0.26
33 0.24
34 0.24
35 0.24
36 0.26
37 0.27
38 0.3
39 0.3
40 0.3
41 0.3
42 0.34
43 0.33
44 0.34
45 0.3
46 0.27
47 0.28
48 0.31
49 0.32
50 0.25
51 0.25
52 0.23
53 0.24
54 0.23
55 0.25
56 0.27
57 0.32
58 0.34
59 0.42
60 0.46
61 0.52
62 0.59
63 0.64
64 0.69
65 0.72
66 0.8
67 0.8
68 0.82
69 0.83
70 0.87