Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MIQ8

Protein Details
Accession A0A0C9MIQ8   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
157-184DAPPPIFQLKHRRKPSKKPASSRLPTPVHydrophilic
NLS Segment(s)
PositionSequence
166-176KHRRKPSKKPA
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSQTKNTLLLRQLRSRTAVELVSNASTKSTSDTATTYPLKTINSPSTIDESLNRLPKPTPSPTIDTTNFVPNDGTKCIPSFTTSVPQRSHQFELSSSTPEWALNFQSQFRDIYQRLSQFDSRHCGGSGGGKCSLYSTSPASTAPPPPPNQVSSRSNDAPPPIFQLKHRRKPSKKPASSRLPTPVAIAALQQKKCSQNLESMIPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.46
4 0.4
5 0.35
6 0.28
7 0.26
8 0.24
9 0.23
10 0.22
11 0.19
12 0.16
13 0.14
14 0.13
15 0.16
16 0.15
17 0.13
18 0.14
19 0.16
20 0.17
21 0.23
22 0.25
23 0.22
24 0.22
25 0.23
26 0.23
27 0.23
28 0.28
29 0.26
30 0.27
31 0.27
32 0.28
33 0.3
34 0.3
35 0.28
36 0.24
37 0.24
38 0.27
39 0.31
40 0.29
41 0.26
42 0.26
43 0.3
44 0.35
45 0.35
46 0.35
47 0.33
48 0.38
49 0.4
50 0.46
51 0.42
52 0.39
53 0.36
54 0.37
55 0.33
56 0.28
57 0.25
58 0.19
59 0.21
60 0.2
61 0.19
62 0.13
63 0.14
64 0.14
65 0.14
66 0.14
67 0.13
68 0.13
69 0.21
70 0.23
71 0.27
72 0.28
73 0.32
74 0.33
75 0.36
76 0.37
77 0.3
78 0.28
79 0.23
80 0.26
81 0.24
82 0.23
83 0.18
84 0.16
85 0.15
86 0.14
87 0.13
88 0.1
89 0.1
90 0.1
91 0.1
92 0.11
93 0.11
94 0.12
95 0.13
96 0.12
97 0.17
98 0.15
99 0.19
100 0.22
101 0.24
102 0.25
103 0.27
104 0.3
105 0.26
106 0.28
107 0.29
108 0.26
109 0.25
110 0.23
111 0.2
112 0.17
113 0.23
114 0.22
115 0.2
116 0.2
117 0.19
118 0.19
119 0.2
120 0.2
121 0.13
122 0.13
123 0.13
124 0.12
125 0.13
126 0.14
127 0.15
128 0.17
129 0.2
130 0.23
131 0.26
132 0.28
133 0.31
134 0.34
135 0.34
136 0.35
137 0.38
138 0.37
139 0.37
140 0.41
141 0.4
142 0.38
143 0.38
144 0.38
145 0.34
146 0.31
147 0.33
148 0.3
149 0.28
150 0.33
151 0.42
152 0.49
153 0.57
154 0.66
155 0.7
156 0.75
157 0.85
158 0.91
159 0.91
160 0.9
161 0.89
162 0.89
163 0.89
164 0.85
165 0.81
166 0.77
167 0.7
168 0.6
169 0.53
170 0.45
171 0.35
172 0.3
173 0.26
174 0.27
175 0.31
176 0.32
177 0.32
178 0.35
179 0.39
180 0.42
181 0.44
182 0.37
183 0.38
184 0.42
185 0.44