Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9MKX0

Protein Details
Accession A0A0C9MKX0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MEHKVCAPGHSKRRPHRNLLKHSHFDPBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036427  Bromodomain-like_sf  
Amino Acid Sequences MEHKVCAPGHSKRRPHRNLLKHSHFDPVVSEPNNHYLAILLRLNLLTIEFASGMRLIFTNCYTFNAEGHFLSRNAKILEKALNMEASKLQRKEQNPKSSIGIARSVLPMEAKLGKYYSVSDKMKRRPSYHLFQVLLDAELLGTLSHHDIAKLPMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.86
4 0.86
5 0.87
6 0.88
7 0.87
8 0.82
9 0.76
10 0.72
11 0.61
12 0.51
13 0.43
14 0.37
15 0.34
16 0.3
17 0.3
18 0.25
19 0.3
20 0.3
21 0.27
22 0.22
23 0.16
24 0.16
25 0.19
26 0.17
27 0.12
28 0.12
29 0.12
30 0.12
31 0.11
32 0.1
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.09
48 0.11
49 0.13
50 0.13
51 0.13
52 0.14
53 0.14
54 0.12
55 0.13
56 0.12
57 0.11
58 0.13
59 0.13
60 0.14
61 0.13
62 0.14
63 0.13
64 0.14
65 0.16
66 0.14
67 0.15
68 0.13
69 0.14
70 0.13
71 0.13
72 0.14
73 0.15
74 0.2
75 0.2
76 0.22
77 0.26
78 0.31
79 0.41
80 0.47
81 0.53
82 0.5
83 0.51
84 0.51
85 0.5
86 0.48
87 0.39
88 0.33
89 0.24
90 0.23
91 0.21
92 0.19
93 0.14
94 0.12
95 0.1
96 0.1
97 0.13
98 0.12
99 0.13
100 0.13
101 0.14
102 0.14
103 0.17
104 0.2
105 0.25
106 0.29
107 0.35
108 0.43
109 0.52
110 0.61
111 0.65
112 0.63
113 0.64
114 0.67
115 0.69
116 0.69
117 0.69
118 0.6
119 0.53
120 0.53
121 0.45
122 0.38
123 0.29
124 0.19
125 0.1
126 0.09
127 0.09
128 0.05
129 0.04
130 0.05
131 0.06
132 0.09
133 0.09
134 0.1
135 0.11