Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MDU5

Protein Details
Accession A0A0C9MDU5   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
106-130NSNNNRRSNNHYSHNKQQRQQQQQQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MASTLKAAATQATKSTITPTRAFFRVSDNIPSVAHAREVFKTLGSYGDMVEYKLLRCPETFQYLRYGFVVYKHNQDAQKAMADQFIKVQSELFDKPLDVKVEKSVNSNNNRRSNNHYSHNKQQRQQQQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.25
3 0.28
4 0.3
5 0.32
6 0.34
7 0.36
8 0.37
9 0.38
10 0.33
11 0.33
12 0.34
13 0.33
14 0.34
15 0.31
16 0.3
17 0.28
18 0.29
19 0.24
20 0.19
21 0.18
22 0.15
23 0.15
24 0.15
25 0.18
26 0.16
27 0.15
28 0.15
29 0.13
30 0.13
31 0.11
32 0.1
33 0.08
34 0.1
35 0.1
36 0.09
37 0.1
38 0.09
39 0.09
40 0.12
41 0.12
42 0.11
43 0.11
44 0.14
45 0.16
46 0.23
47 0.23
48 0.21
49 0.26
50 0.26
51 0.26
52 0.23
53 0.21
54 0.14
55 0.17
56 0.21
57 0.17
58 0.2
59 0.21
60 0.25
61 0.25
62 0.26
63 0.24
64 0.21
65 0.22
66 0.18
67 0.17
68 0.16
69 0.15
70 0.15
71 0.16
72 0.17
73 0.15
74 0.14
75 0.14
76 0.12
77 0.16
78 0.16
79 0.15
80 0.14
81 0.13
82 0.16
83 0.19
84 0.21
85 0.18
86 0.18
87 0.22
88 0.26
89 0.27
90 0.29
91 0.33
92 0.38
93 0.46
94 0.53
95 0.57
96 0.62
97 0.64
98 0.64
99 0.66
100 0.67
101 0.65
102 0.67
103 0.68
104 0.66
105 0.74
106 0.81
107 0.8
108 0.77
109 0.79
110 0.8