Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9LUB8

Protein Details
Accession A0A0C9LUB8   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-103SDANGSHHNKRKKRKDRTSTTFPSTHydrophilic
NLS Segment(s)
PositionSequence
87-93NKRKKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSSVDNKDPNDFTTGSAHPHYRNIPLDLTTSPLEKYFQDMYLAEMNEQELLTDTTTAASSDESLRHHSRVQPIWIPGASDANGSHHNKRKKRKDRTSTTFPSTMNTFATLFDNSYTSRQPIISVAERTQSQNQVAQIRKHAFTVGSLVDRPPAPWPASFTVPHDGNDGKTWSSHQQDNDSASDSIESGDILFDCESDPEDTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.28
4 0.3
5 0.28
6 0.33
7 0.33
8 0.35
9 0.37
10 0.36
11 0.34
12 0.32
13 0.32
14 0.27
15 0.28
16 0.23
17 0.2
18 0.18
19 0.17
20 0.17
21 0.14
22 0.19
23 0.18
24 0.17
25 0.18
26 0.18
27 0.2
28 0.23
29 0.23
30 0.18
31 0.16
32 0.16
33 0.14
34 0.14
35 0.1
36 0.07
37 0.08
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.08
44 0.07
45 0.06
46 0.07
47 0.08
48 0.1
49 0.11
50 0.17
51 0.19
52 0.21
53 0.23
54 0.26
55 0.31
56 0.33
57 0.36
58 0.34
59 0.33
60 0.34
61 0.32
62 0.28
63 0.22
64 0.19
65 0.15
66 0.12
67 0.1
68 0.1
69 0.16
70 0.18
71 0.24
72 0.3
73 0.39
74 0.45
75 0.56
76 0.65
77 0.7
78 0.78
79 0.83
80 0.86
81 0.88
82 0.89
83 0.88
84 0.83
85 0.77
86 0.69
87 0.58
88 0.49
89 0.39
90 0.32
91 0.22
92 0.18
93 0.13
94 0.1
95 0.12
96 0.1
97 0.1
98 0.09
99 0.1
100 0.09
101 0.11
102 0.11
103 0.11
104 0.11
105 0.11
106 0.11
107 0.11
108 0.15
109 0.17
110 0.18
111 0.18
112 0.19
113 0.2
114 0.23
115 0.25
116 0.23
117 0.21
118 0.21
119 0.24
120 0.28
121 0.32
122 0.31
123 0.35
124 0.36
125 0.35
126 0.33
127 0.31
128 0.24
129 0.2
130 0.21
131 0.16
132 0.14
133 0.14
134 0.14
135 0.15
136 0.15
137 0.15
138 0.15
139 0.17
140 0.17
141 0.17
142 0.22
143 0.23
144 0.27
145 0.27
146 0.28
147 0.31
148 0.3
149 0.3
150 0.29
151 0.26
152 0.24
153 0.26
154 0.25
155 0.18
156 0.17
157 0.2
158 0.24
159 0.28
160 0.31
161 0.31
162 0.35
163 0.38
164 0.41
165 0.4
166 0.37
167 0.32
168 0.27
169 0.24
170 0.19
171 0.15
172 0.12
173 0.1
174 0.06
175 0.07
176 0.07
177 0.08
178 0.08
179 0.07
180 0.08
181 0.09
182 0.11