Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9M5A2

Protein Details
Accession A0A0C9M5A2   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MSKTSSKHTKRQSKPKDVLEQLRKLAKKHKKSKDTSSEKAHydrophilic
NLS Segment(s)
PositionSequence
10-33KRQSKPKDVLEQLRKLAKKHKKSK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019532  Nucl_RNA-splicing_assoc_SR-25  
Gene Ontology GO:0016607  C:nuclear speck  
GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF10500  SR-25  
Amino Acid Sequences MSKTSSKHTKRQSKPKDVLEQLRKLAKKHKKSKDTSSEKAASCNAMTPMTKDEYERKRSTITTEYDAQTGRMRRKRATGEILETIVTKEQHLKINQMSTWMDGLSYQRQVIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.85
5 0.85
6 0.82
7 0.77
8 0.71
9 0.7
10 0.63
11 0.56
12 0.58
13 0.58
14 0.6
15 0.65
16 0.7
17 0.73
18 0.77
19 0.85
20 0.86
21 0.85
22 0.78
23 0.76
24 0.72
25 0.62
26 0.57
27 0.47
28 0.37
29 0.29
30 0.26
31 0.19
32 0.14
33 0.14
34 0.13
35 0.14
36 0.15
37 0.15
38 0.15
39 0.22
40 0.27
41 0.34
42 0.34
43 0.33
44 0.33
45 0.34
46 0.36
47 0.34
48 0.29
49 0.26
50 0.28
51 0.28
52 0.27
53 0.27
54 0.24
55 0.22
56 0.24
57 0.29
58 0.31
59 0.34
60 0.35
61 0.42
62 0.47
63 0.49
64 0.52
65 0.47
66 0.47
67 0.45
68 0.44
69 0.37
70 0.31
71 0.25
72 0.2
73 0.16
74 0.12
75 0.16
76 0.19
77 0.25
78 0.27
79 0.31
80 0.32
81 0.37
82 0.36
83 0.35
84 0.32
85 0.27
86 0.27
87 0.22
88 0.18
89 0.14
90 0.18
91 0.19
92 0.2
93 0.2