Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MNU4

Protein Details
Accession A0A0C9MNU4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
76-98MELIKNSRDKRARKLCKAKLGTFHydrophilic
NLS Segment(s)
PositionSequence
84-95DKRARKLCKAKL
100-103RAKK
Subcellular Location(s) mito 13cyto 13cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAASGIAVGINKGHIVTRRVLKAKPSNKIGVCIHKVDGWMDENVNEASRAASKRATFVRSIVREVSGYAPYERRVMELIKNSRDKRARKLCKAKLGTFLRAKKKIEELSSVIASSRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.22
4 0.28
5 0.36
6 0.39
7 0.41
8 0.47
9 0.53
10 0.58
11 0.61
12 0.59
13 0.6
14 0.57
15 0.61
16 0.56
17 0.55
18 0.5
19 0.44
20 0.39
21 0.33
22 0.32
23 0.27
24 0.24
25 0.18
26 0.15
27 0.13
28 0.12
29 0.12
30 0.12
31 0.12
32 0.09
33 0.08
34 0.07
35 0.1
36 0.11
37 0.1
38 0.13
39 0.13
40 0.17
41 0.2
42 0.21
43 0.19
44 0.2
45 0.27
46 0.25
47 0.27
48 0.24
49 0.21
50 0.19
51 0.2
52 0.19
53 0.13
54 0.12
55 0.12
56 0.13
57 0.13
58 0.15
59 0.14
60 0.13
61 0.13
62 0.14
63 0.17
64 0.25
65 0.29
66 0.34
67 0.43
68 0.43
69 0.5
70 0.56
71 0.56
72 0.58
73 0.64
74 0.67
75 0.7
76 0.8
77 0.8
78 0.82
79 0.85
80 0.78
81 0.77
82 0.72
83 0.7
84 0.68
85 0.68
86 0.67
87 0.67
88 0.66
89 0.6
90 0.63
91 0.61
92 0.56
93 0.54
94 0.48
95 0.47
96 0.46
97 0.41
98 0.34