Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MLL0

Protein Details
Accession A0A0C9MLL0    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-37KPSSSSGGKKAKKKWSAKKVKDKANNLVIHydrophilic
NLS Segment(s)
PositionSequence
9-31KPSSSSGGKKAKKKWSAKKVKDK
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDVAGKPSSSSGGKKAKKKWSAKKVKDKANNLVILDKPTYDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELEAQGLIKAISRHHAQVIYTRATGDEKKPVASEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.47
4 0.52
5 0.58
6 0.65
7 0.72
8 0.8
9 0.82
10 0.83
11 0.87
12 0.89
13 0.92
14 0.9
15 0.91
16 0.89
17 0.85
18 0.82
19 0.78
20 0.71
21 0.6
22 0.54
23 0.45
24 0.38
25 0.32
26 0.24
27 0.18
28 0.18
29 0.19
30 0.16
31 0.16
32 0.18
33 0.19
34 0.19
35 0.26
36 0.28
37 0.28
38 0.3
39 0.32
40 0.28
41 0.31
42 0.3
43 0.23
44 0.18
45 0.18
46 0.16
47 0.18
48 0.17
49 0.14
50 0.13
51 0.14
52 0.15
53 0.13
54 0.13
55 0.1
56 0.12
57 0.12
58 0.12
59 0.12
60 0.11
61 0.11
62 0.11
63 0.1
64 0.1
65 0.09
66 0.1
67 0.08
68 0.09
69 0.09
70 0.08
71 0.07
72 0.08
73 0.09
74 0.09
75 0.13
76 0.15
77 0.17
78 0.19
79 0.21
80 0.2
81 0.26
82 0.3
83 0.29
84 0.27
85 0.26
86 0.24
87 0.27
88 0.3
89 0.27
90 0.31
91 0.29
92 0.31