Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9MKI9

Protein Details
Accession A0A0C9MKI9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
114-138PLPTASSAKRKAKKRLRLDYYFNLKHydrophilic
NLS Segment(s)
PositionSequence
122-128KRKAKKR
Subcellular Location(s) nucl 8cyto 8cyto_nucl 8, mito 4
Family & Domain DBs
Amino Acid Sequences MFPKLGIHDSQVLDIHFPVHTVVSFLMHYDFMLEFTTLMKNQLHVDPLLDFDPLEDRNLLDPTFSSLESVSRSQKTNDLYNKRVLGVISFFLPKLMPFWLIPWRLAPNSLLPLPLPTASSAKRKAKKRLRLDYYFNLKYLDPLSASTIASSSPLTFSLSPTPTGPQANDVSMQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.12
4 0.12
5 0.1
6 0.09
7 0.09
8 0.09
9 0.09
10 0.1
11 0.1
12 0.1
13 0.1
14 0.1
15 0.09
16 0.1
17 0.1
18 0.08
19 0.1
20 0.09
21 0.08
22 0.09
23 0.12
24 0.1
25 0.13
26 0.12
27 0.12
28 0.15
29 0.16
30 0.17
31 0.15
32 0.15
33 0.13
34 0.15
35 0.14
36 0.11
37 0.09
38 0.08
39 0.11
40 0.1
41 0.11
42 0.09
43 0.09
44 0.11
45 0.13
46 0.12
47 0.09
48 0.09
49 0.11
50 0.13
51 0.12
52 0.11
53 0.1
54 0.11
55 0.13
56 0.15
57 0.16
58 0.16
59 0.18
60 0.18
61 0.22
62 0.24
63 0.29
64 0.35
65 0.38
66 0.38
67 0.41
68 0.41
69 0.37
70 0.35
71 0.28
72 0.2
73 0.14
74 0.12
75 0.09
76 0.09
77 0.08
78 0.07
79 0.07
80 0.06
81 0.07
82 0.07
83 0.07
84 0.07
85 0.09
86 0.15
87 0.16
88 0.17
89 0.18
90 0.2
91 0.18
92 0.19
93 0.18
94 0.14
95 0.16
96 0.16
97 0.15
98 0.12
99 0.13
100 0.13
101 0.12
102 0.11
103 0.09
104 0.12
105 0.15
106 0.22
107 0.29
108 0.37
109 0.45
110 0.52
111 0.62
112 0.69
113 0.76
114 0.8
115 0.83
116 0.83
117 0.82
118 0.82
119 0.8
120 0.79
121 0.71
122 0.61
123 0.52
124 0.43
125 0.38
126 0.31
127 0.23
128 0.14
129 0.14
130 0.16
131 0.16
132 0.16
133 0.14
134 0.14
135 0.12
136 0.12
137 0.12
138 0.09
139 0.08
140 0.09
141 0.12
142 0.13
143 0.15
144 0.22
145 0.22
146 0.24
147 0.24
148 0.26
149 0.27
150 0.29
151 0.27
152 0.25
153 0.26
154 0.26