Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9N6W6

Protein Details
Accession A0A0C9N6W6   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
166-200AIKQQEEDEKQKRREKKKQKKDHKKKPADEEDGEDBasic
NLS Segment(s)
PositionSequence
26-56KAKARENRDRLAEKNDERKKLGLPPLKPKRR
175-192KQKRREKKKQKKDHKKKP
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR040107  Snu23  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12874  zf-met  
Amino Acid Sequences MSAYGAGKAKDTDFRRTWNKEEYAAKAKARENRDRLAEKNDERKKLGLPPLKPKRRYDDDDESKEALKAREEKVDIESNVGKVQVVQAADSRKQPGFYCKACDITIKDSVTWIDHLNGRKHLNNVGVSSKVEKADLSSVKERLAMLKRKKENPQKEEYNLDERLAAIKQQEEDEKQKRREKKKQKKDHKKKPADEEDGEDEMAKLMGFSGFGSSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.56
4 0.59
5 0.59
6 0.59
7 0.57
8 0.58
9 0.58
10 0.56
11 0.56
12 0.52
13 0.5
14 0.52
15 0.52
16 0.55
17 0.58
18 0.55
19 0.56
20 0.62
21 0.61
22 0.59
23 0.59
24 0.6
25 0.57
26 0.62
27 0.63
28 0.6
29 0.57
30 0.56
31 0.51
32 0.5
33 0.53
34 0.5
35 0.49
36 0.55
37 0.64
38 0.71
39 0.74
40 0.71
41 0.71
42 0.71
43 0.72
44 0.69
45 0.69
46 0.69
47 0.69
48 0.68
49 0.6
50 0.52
51 0.47
52 0.41
53 0.3
54 0.25
55 0.24
56 0.23
57 0.27
58 0.27
59 0.27
60 0.29
61 0.33
62 0.28
63 0.27
64 0.26
65 0.21
66 0.2
67 0.19
68 0.15
69 0.1
70 0.1
71 0.09
72 0.08
73 0.08
74 0.1
75 0.13
76 0.15
77 0.17
78 0.19
79 0.17
80 0.18
81 0.19
82 0.23
83 0.26
84 0.25
85 0.29
86 0.27
87 0.29
88 0.28
89 0.3
90 0.25
91 0.23
92 0.26
93 0.22
94 0.2
95 0.18
96 0.18
97 0.16
98 0.15
99 0.12
100 0.09
101 0.12
102 0.16
103 0.18
104 0.22
105 0.24
106 0.25
107 0.25
108 0.27
109 0.27
110 0.25
111 0.24
112 0.22
113 0.2
114 0.19
115 0.2
116 0.18
117 0.15
118 0.14
119 0.12
120 0.11
121 0.16
122 0.18
123 0.21
124 0.22
125 0.23
126 0.23
127 0.24
128 0.23
129 0.23
130 0.29
131 0.33
132 0.38
133 0.47
134 0.54
135 0.6
136 0.7
137 0.74
138 0.77
139 0.75
140 0.75
141 0.73
142 0.7
143 0.69
144 0.63
145 0.58
146 0.49
147 0.42
148 0.33
149 0.26
150 0.25
151 0.19
152 0.16
153 0.11
154 0.12
155 0.13
156 0.15
157 0.19
158 0.22
159 0.31
160 0.38
161 0.46
162 0.53
163 0.6
164 0.67
165 0.74
166 0.81
167 0.83
168 0.86
169 0.88
170 0.91
171 0.94
172 0.96
173 0.97
174 0.97
175 0.97
176 0.97
177 0.95
178 0.94
179 0.93
180 0.9
181 0.81
182 0.76
183 0.71
184 0.62
185 0.53
186 0.42
187 0.31
188 0.23
189 0.2
190 0.13
191 0.07
192 0.06
193 0.06
194 0.06
195 0.06
196 0.1