Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9M2C4

Protein Details
Accession A0A0C9M2C4   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKDKIQKKSPKKMSPYNQFMKTHydrophilic
49-77SKAPENPKNKKEEKKEEKKEEKKEEKAAEBasic
NLS Segment(s)
PositionSequence
52-75PENPKNKKEEKKEEKKEEKKEEKA
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKDKIQKKSPKKMSPYNQFMKTELAKVKEANAGIAHKDAFKMAAQNWSKAPENPKNKKEEKKEEKKEEKKEEKAAEATEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.86
4 0.83
5 0.79
6 0.71
7 0.64
8 0.59
9 0.5
10 0.45
11 0.39
12 0.34
13 0.29
14 0.28
15 0.29
16 0.26
17 0.25
18 0.2
19 0.18
20 0.15
21 0.14
22 0.15
23 0.13
24 0.1
25 0.1
26 0.09
27 0.08
28 0.07
29 0.08
30 0.08
31 0.17
32 0.18
33 0.19
34 0.2
35 0.23
36 0.24
37 0.25
38 0.32
39 0.32
40 0.42
41 0.5
42 0.55
43 0.6
44 0.67
45 0.74
46 0.76
47 0.78
48 0.79
49 0.81
50 0.86
51 0.88
52 0.91
53 0.92
54 0.92
55 0.92
56 0.9
57 0.87
58 0.85
59 0.79
60 0.74
61 0.68
62 0.59