Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9MIF0

Protein Details
Accession A0A0C9MIF0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-51MVAPSKKAPKKACRGRPPKKSILHKNATHydrophilic
NLS Segment(s)
PositionSequence
28-44SKKAPKKACRGRPPKKS
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MSSMPNKNIAHKPEASTEIQPAGMVAPSKKAPKKACRGRPPKKSILHKNATAESSGPRIESTPASSNTFAAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.35
4 0.32
5 0.27
6 0.24
7 0.21
8 0.16
9 0.12
10 0.1
11 0.09
12 0.08
13 0.09
14 0.12
15 0.19
16 0.22
17 0.29
18 0.35
19 0.43
20 0.53
21 0.61
22 0.68
23 0.72
24 0.81
25 0.83
26 0.86
27 0.85
28 0.83
29 0.82
30 0.82
31 0.82
32 0.81
33 0.77
34 0.71
35 0.68
36 0.62
37 0.54
38 0.45
39 0.35
40 0.27
41 0.24
42 0.2
43 0.16
44 0.14
45 0.14
46 0.15
47 0.16
48 0.2
49 0.23
50 0.26
51 0.3
52 0.3