Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MVF1

Protein Details
Accession A0A0C9MVF1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
61-81LIKNSRDKRARKLCKAKLGSFHydrophilic
NLS Segment(s)
PositionSequence
66-86RDKRARKLCKAKLGSFLRAKK
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MVAAKSGIAVGLNKGHITARRELKAKPSNKIGAASKRTVFVKSVIREVAGFAPYERRLMELIKNSRDKRARKLCKAKLGSFLRAKKKVEELQAVIASTRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.2
4 0.23
5 0.29
6 0.33
7 0.38
8 0.4
9 0.41
10 0.49
11 0.53
12 0.53
13 0.51
14 0.51
15 0.5
16 0.49
17 0.52
18 0.48
19 0.48
20 0.48
21 0.46
22 0.39
23 0.38
24 0.37
25 0.34
26 0.29
27 0.24
28 0.26
29 0.24
30 0.26
31 0.23
32 0.22
33 0.21
34 0.21
35 0.19
36 0.12
37 0.1
38 0.08
39 0.11
40 0.11
41 0.12
42 0.11
43 0.1
44 0.11
45 0.12
46 0.16
47 0.21
48 0.26
49 0.32
50 0.4
51 0.4
52 0.47
53 0.54
54 0.54
55 0.56
56 0.62
57 0.66
58 0.69
59 0.79
60 0.79
61 0.81
62 0.84
63 0.77
64 0.76
65 0.71
66 0.69
67 0.67
68 0.67
69 0.66
70 0.66
71 0.65
72 0.59
73 0.62
74 0.61
75 0.59
76 0.58
77 0.51
78 0.51
79 0.51
80 0.47
81 0.39