Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9MK69

Protein Details
Accession A0A0C9MK69    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-47RSPSPPSTKRYSSRQRERDYRDLDNPRSRSRSPGSSRRRHREDSFHydrophilic
51-100ESRGRRRDDSRDRYRRSRSSRSPPSRRDRRSPDRRDRGRPRNRSRSRSESBasic
170-190GAKIHKPIKYRQYMNRRGGFNHydrophilic
NLS Segment(s)
PositionSequence
29-122RSRSRSPGSSRRRHREDSFDRYESRGRRRDDSRDRYRRSRSSRSPPSRRDRRSPDRRDRGRPRNRSRSRSESPSYRRPRSRDGPVSKRPDPKKP
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MPRSPSPPSTKRYSSRQRERDYRDLDNPRSRSRSPGSSRRRHREDSFDRYESRGRRRDDSRDRYRRSRSSRSPPSRRDRRSPDRRDRGRPRNRSRSRSESPSYRRPRSRDGPVSKRPDPKKPVAEDKVEHMDQDGEEEEEDDETRMMKLMGFGGFDTTKNKKVPGADVSGAKIHKPIKYRQYMNRRGGFNRPLDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.83
4 0.84
5 0.86
6 0.88
7 0.87
8 0.83
9 0.79
10 0.77
11 0.76
12 0.75
13 0.74
14 0.71
15 0.68
16 0.68
17 0.62
18 0.59
19 0.56
20 0.58
21 0.57
22 0.62
23 0.65
24 0.69
25 0.79
26 0.82
27 0.83
28 0.81
29 0.77
30 0.78
31 0.76
32 0.75
33 0.72
34 0.66
35 0.6
36 0.56
37 0.57
38 0.53
39 0.53
40 0.52
41 0.48
42 0.51
43 0.55
44 0.63
45 0.67
46 0.71
47 0.73
48 0.76
49 0.78
50 0.8
51 0.83
52 0.81
53 0.79
54 0.79
55 0.77
56 0.77
57 0.82
58 0.84
59 0.85
60 0.85
61 0.87
62 0.87
63 0.84
64 0.83
65 0.82
66 0.82
67 0.83
68 0.85
69 0.85
70 0.85
71 0.87
72 0.88
73 0.88
74 0.88
75 0.87
76 0.88
77 0.87
78 0.87
79 0.88
80 0.85
81 0.81
82 0.79
83 0.74
84 0.7
85 0.64
86 0.62
87 0.6
88 0.64
89 0.65
90 0.64
91 0.64
92 0.61
93 0.65
94 0.63
95 0.66
96 0.65
97 0.66
98 0.67
99 0.7
100 0.74
101 0.72
102 0.74
103 0.69
104 0.68
105 0.66
106 0.65
107 0.64
108 0.62
109 0.65
110 0.61
111 0.62
112 0.53
113 0.52
114 0.5
115 0.42
116 0.36
117 0.27
118 0.23
119 0.18
120 0.18
121 0.14
122 0.08
123 0.08
124 0.09
125 0.08
126 0.08
127 0.08
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.08
137 0.09
138 0.09
139 0.09
140 0.12
141 0.13
142 0.13
143 0.18
144 0.2
145 0.25
146 0.26
147 0.28
148 0.28
149 0.3
150 0.35
151 0.35
152 0.37
153 0.35
154 0.35
155 0.36
156 0.38
157 0.35
158 0.3
159 0.3
160 0.27
161 0.28
162 0.31
163 0.38
164 0.44
165 0.53
166 0.61
167 0.66
168 0.73
169 0.79
170 0.84
171 0.82
172 0.77
173 0.72
174 0.73
175 0.7