Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9N7D9

Protein Details
Accession A0A0C9N7D9    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
90-116LLDEKKQKQKTTKPVNRQYHRKQSREAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSTLVRSSRPLLQHNLPRASYLHSCAIIRNVASEPTTPASTPSTTTATTQRKPSSAPKGTVLKGIQYLKDKQDPVALDDSEYPEWLWDLLDEKKQKQKTTKPVNRQYHRKQSREAIKAMNFMKDKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.59
4 0.53
5 0.49
6 0.45
7 0.44
8 0.38
9 0.34
10 0.29
11 0.25
12 0.25
13 0.25
14 0.26
15 0.23
16 0.2
17 0.18
18 0.15
19 0.15
20 0.16
21 0.15
22 0.15
23 0.16
24 0.17
25 0.14
26 0.15
27 0.16
28 0.16
29 0.17
30 0.17
31 0.17
32 0.17
33 0.18
34 0.25
35 0.29
36 0.32
37 0.36
38 0.35
39 0.34
40 0.36
41 0.42
42 0.43
43 0.42
44 0.41
45 0.4
46 0.42
47 0.42
48 0.43
49 0.36
50 0.27
51 0.26
52 0.26
53 0.23
54 0.22
55 0.24
56 0.23
57 0.28
58 0.27
59 0.23
60 0.26
61 0.24
62 0.23
63 0.24
64 0.21
65 0.17
66 0.17
67 0.2
68 0.16
69 0.16
70 0.13
71 0.09
72 0.09
73 0.08
74 0.07
75 0.05
76 0.08
77 0.1
78 0.17
79 0.2
80 0.24
81 0.33
82 0.38
83 0.44
84 0.5
85 0.57
86 0.62
87 0.7
88 0.76
89 0.78
90 0.84
91 0.89
92 0.89
93 0.91
94 0.9
95 0.9
96 0.89
97 0.83
98 0.79
99 0.79
100 0.79
101 0.75
102 0.69
103 0.66
104 0.6
105 0.62
106 0.57
107 0.55
108 0.48