Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9M4S1

Protein Details
Accession A0A0C9M4S1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
115-145HTKSKLIQVVKKKRRKNYKRTIEHKQTHTVLHydrophilic
NLS Segment(s)
PositionSequence
125-134KKKRRKNYKR
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
IPR001787  Ribosomal_L21  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MATCTFCVGSTQLVRQQPLQNTLQRQVQTSAYDTTATVQKLRDQLRYYAVAEIAGRPFLITKNDKVIVNRLKDVKVGDVLKLDKVRELGSKDYTLKGSPYVPENVFNINATVIEHTKSKLIQVVKKKRRKNYKRTIEHKQTHTVLRISNVDVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.43
4 0.42
5 0.44
6 0.46
7 0.45
8 0.46
9 0.49
10 0.49
11 0.44
12 0.41
13 0.38
14 0.36
15 0.31
16 0.29
17 0.27
18 0.21
19 0.21
20 0.18
21 0.18
22 0.19
23 0.18
24 0.17
25 0.16
26 0.19
27 0.26
28 0.29
29 0.32
30 0.31
31 0.32
32 0.35
33 0.37
34 0.34
35 0.28
36 0.25
37 0.19
38 0.17
39 0.16
40 0.13
41 0.1
42 0.08
43 0.07
44 0.07
45 0.08
46 0.13
47 0.14
48 0.15
49 0.2
50 0.23
51 0.24
52 0.24
53 0.31
54 0.32
55 0.32
56 0.34
57 0.31
58 0.29
59 0.29
60 0.28
61 0.21
62 0.19
63 0.18
64 0.15
65 0.15
66 0.15
67 0.17
68 0.18
69 0.17
70 0.13
71 0.14
72 0.14
73 0.15
74 0.17
75 0.17
76 0.18
77 0.21
78 0.21
79 0.22
80 0.22
81 0.19
82 0.17
83 0.16
84 0.15
85 0.14
86 0.15
87 0.18
88 0.18
89 0.19
90 0.2
91 0.2
92 0.19
93 0.18
94 0.16
95 0.11
96 0.11
97 0.09
98 0.1
99 0.09
100 0.1
101 0.1
102 0.11
103 0.13
104 0.13
105 0.14
106 0.17
107 0.22
108 0.28
109 0.38
110 0.49
111 0.58
112 0.67
113 0.74
114 0.79
115 0.85
116 0.89
117 0.89
118 0.89
119 0.9
120 0.91
121 0.91
122 0.92
123 0.91
124 0.89
125 0.84
126 0.81
127 0.75
128 0.7
129 0.67
130 0.59
131 0.5
132 0.46
133 0.43