Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BYY2

Protein Details
Accession Q6BYY2   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
212-235HKGKIVSREEKLKKQFKKKKSDDKBasic
NLS Segment(s)
PositionSequence
213-235KGKIVSREEKLKKQFKKKKSDDK
Subcellular Location(s) mito 16.5, cyto_mito 9.833, nucl 8.5, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
KEGG dha:DEHA2A06072g  -  
Amino Acid Sequences MLRISKMCYGVSAKAGYRTATSKPIEFLPSHLVVQKPYDFHAIHTNYGWFIIPKPYYAYRWTTSNIHKAIEDRYPDIKDVPRSHEMLQKVVDDWGQTVDLSTKPITTKTTRADIKKQKDDALYRTQLKEDMPSLVTPSKQTTVPKKRSRLGTVTFIHAWNYYFSITHPKYSHLDKKESRREIANEWNAMTTEEKDDYREAYANLLNDGKDIHKGKIVSREEKLKKQFKKKKSDDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.29
4 0.28
5 0.28
6 0.27
7 0.31
8 0.33
9 0.29
10 0.3
11 0.32
12 0.33
13 0.3
14 0.3
15 0.29
16 0.28
17 0.28
18 0.29
19 0.27
20 0.24
21 0.28
22 0.28
23 0.23
24 0.23
25 0.28
26 0.25
27 0.26
28 0.34
29 0.32
30 0.3
31 0.3
32 0.29
33 0.22
34 0.23
35 0.21
36 0.12
37 0.12
38 0.17
39 0.16
40 0.16
41 0.2
42 0.23
43 0.25
44 0.28
45 0.32
46 0.28
47 0.3
48 0.33
49 0.35
50 0.37
51 0.43
52 0.4
53 0.36
54 0.34
55 0.33
56 0.33
57 0.31
58 0.28
59 0.24
60 0.26
61 0.26
62 0.26
63 0.27
64 0.28
65 0.31
66 0.31
67 0.34
68 0.33
69 0.35
70 0.36
71 0.38
72 0.35
73 0.3
74 0.29
75 0.23
76 0.2
77 0.18
78 0.17
79 0.12
80 0.11
81 0.09
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.09
88 0.09
89 0.09
90 0.09
91 0.11
92 0.14
93 0.15
94 0.2
95 0.21
96 0.28
97 0.32
98 0.36
99 0.44
100 0.5
101 0.56
102 0.58
103 0.57
104 0.52
105 0.52
106 0.51
107 0.46
108 0.44
109 0.41
110 0.36
111 0.35
112 0.32
113 0.29
114 0.26
115 0.24
116 0.17
117 0.14
118 0.12
119 0.11
120 0.14
121 0.14
122 0.14
123 0.13
124 0.14
125 0.14
126 0.16
127 0.21
128 0.29
129 0.38
130 0.48
131 0.55
132 0.59
133 0.63
134 0.68
135 0.68
136 0.64
137 0.58
138 0.56
139 0.5
140 0.48
141 0.44
142 0.37
143 0.33
144 0.27
145 0.23
146 0.15
147 0.15
148 0.11
149 0.1
150 0.1
151 0.2
152 0.2
153 0.25
154 0.25
155 0.27
156 0.3
157 0.38
158 0.46
159 0.4
160 0.49
161 0.5
162 0.6
163 0.67
164 0.69
165 0.64
166 0.61
167 0.59
168 0.56
169 0.59
170 0.55
171 0.46
172 0.42
173 0.4
174 0.34
175 0.32
176 0.28
177 0.19
178 0.16
179 0.16
180 0.16
181 0.17
182 0.18
183 0.18
184 0.2
185 0.2
186 0.17
187 0.18
188 0.2
189 0.19
190 0.2
191 0.2
192 0.17
193 0.16
194 0.17
195 0.14
196 0.2
197 0.22
198 0.21
199 0.24
200 0.26
201 0.3
202 0.38
203 0.45
204 0.44
205 0.47
206 0.56
207 0.59
208 0.67
209 0.73
210 0.73
211 0.76
212 0.81
213 0.85
214 0.84
215 0.88