Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MW94

Protein Details
Accession A0A0C9MW94   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-136TTSTLKKKTSSSKKNQKKRKRNHGATAAHKQTVHydrophilic
NLS Segment(s)
PositionSequence
109-126KKKTSSSKKNQKKRKRNH
Subcellular Location(s) nucl 23.5, cyto_nucl 14.833, mito_nucl 13.332
Family & Domain DBs
Amino Acid Sequences MLSSPNSNEPHHQFPRRVSFDLSHNTVYLLPTLEQCRDAAKQRSREEWQRKTLNEDMLSEDIIVEIQEDCSAGSRDSEEEGESVQSEPVPTKSCLKKPPVVTATTSTLKKKTSSSKKNQKKRKRNHGATAAHKQTVQNVISVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.65
4 0.62
5 0.56
6 0.5
7 0.5
8 0.53
9 0.49
10 0.4
11 0.34
12 0.32
13 0.29
14 0.26
15 0.2
16 0.15
17 0.11
18 0.13
19 0.16
20 0.16
21 0.16
22 0.16
23 0.18
24 0.19
25 0.26
26 0.32
27 0.37
28 0.44
29 0.47
30 0.54
31 0.57
32 0.64
33 0.67
34 0.66
35 0.67
36 0.65
37 0.62
38 0.61
39 0.6
40 0.54
41 0.45
42 0.38
43 0.33
44 0.27
45 0.26
46 0.19
47 0.15
48 0.09
49 0.08
50 0.07
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.05
58 0.06
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.08
76 0.11
77 0.12
78 0.19
79 0.25
80 0.31
81 0.38
82 0.42
83 0.47
84 0.47
85 0.56
86 0.52
87 0.48
88 0.45
89 0.42
90 0.41
91 0.4
92 0.4
93 0.33
94 0.33
95 0.33
96 0.32
97 0.35
98 0.4
99 0.46
100 0.54
101 0.62
102 0.7
103 0.79
104 0.88
105 0.93
106 0.93
107 0.93
108 0.94
109 0.94
110 0.94
111 0.93
112 0.93
113 0.92
114 0.9
115 0.88
116 0.88
117 0.81
118 0.72
119 0.63
120 0.54
121 0.49
122 0.47
123 0.38