Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9N5S9

Protein Details
Accession A0A0C9N5S9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-92NLHDTLQSRRERKREKRPQDGKTNPMEHydrophilic
NLS Segment(s)
PositionSequence
74-83RRERKREKRP
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MLQQYYNKNDYMLVQDQKNIMSLDDSDNVSMATTMISDAFPGSKTTSLYGRSSSLCRRISTSIKKNLHDTLQSRRERKREKRPQDGKTNPME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.3
4 0.3
5 0.3
6 0.24
7 0.17
8 0.13
9 0.14
10 0.14
11 0.15
12 0.16
13 0.13
14 0.13
15 0.12
16 0.11
17 0.1
18 0.07
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.06
29 0.07
30 0.08
31 0.08
32 0.09
33 0.12
34 0.14
35 0.14
36 0.15
37 0.15
38 0.16
39 0.19
40 0.22
41 0.28
42 0.28
43 0.27
44 0.29
45 0.33
46 0.4
47 0.46
48 0.51
49 0.54
50 0.57
51 0.58
52 0.59
53 0.58
54 0.53
55 0.49
56 0.44
57 0.44
58 0.48
59 0.54
60 0.57
61 0.61
62 0.67
63 0.71
64 0.78
65 0.8
66 0.82
67 0.84
68 0.89
69 0.92
70 0.91
71 0.91
72 0.89