Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0LCE9

Protein Details
Accession T0LCE9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
178-201GDVVATKTKKNKPKPQDCICPTPSHydrophilic
NLS Segment(s)
PositionSequence
119-121KKK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031507  PTP2  
Pfam View protein in Pfam  
PF17022  PTP2  
Amino Acid Sequences MQDPNHSAMSTLPATAPPLNATKPDNTIPQAPPLIRPNKCCQIRYINGKRICPENTKSPEECMQEAQMKAERRKQELANVAMEAVKAAAKRPEKPEECIKTVDPKEQQCLVKKLQEKAKKKPKYVVSNNSNEVRIFNGNDLIFIAMRIQSHYAKHEPKKAIPSTVKNYDNAIMFNEAGDVVATKTKKNKPKPQDCICPTPSEPPVTKEGLLSECFKPTCKTAGILSEIVSNSTVTNVKDDQKDDKDKDKDDGKSKIKPQDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.16
5 0.2
6 0.2
7 0.23
8 0.26
9 0.25
10 0.28
11 0.31
12 0.33
13 0.32
14 0.37
15 0.36
16 0.38
17 0.4
18 0.36
19 0.38
20 0.42
21 0.48
22 0.46
23 0.5
24 0.52
25 0.58
26 0.63
27 0.59
28 0.56
29 0.57
30 0.61
31 0.66
32 0.68
33 0.67
34 0.67
35 0.69
36 0.66
37 0.61
38 0.58
39 0.54
40 0.48
41 0.49
42 0.5
43 0.53
44 0.51
45 0.5
46 0.51
47 0.48
48 0.45
49 0.37
50 0.34
51 0.33
52 0.32
53 0.3
54 0.29
55 0.32
56 0.35
57 0.4
58 0.41
59 0.41
60 0.46
61 0.45
62 0.47
63 0.48
64 0.46
65 0.4
66 0.35
67 0.31
68 0.26
69 0.24
70 0.16
71 0.09
72 0.08
73 0.06
74 0.07
75 0.14
76 0.16
77 0.21
78 0.27
79 0.37
80 0.38
81 0.42
82 0.51
83 0.5
84 0.5
85 0.48
86 0.44
87 0.43
88 0.42
89 0.44
90 0.39
91 0.35
92 0.37
93 0.4
94 0.42
95 0.38
96 0.41
97 0.38
98 0.39
99 0.41
100 0.43
101 0.46
102 0.52
103 0.53
104 0.59
105 0.67
106 0.68
107 0.67
108 0.69
109 0.69
110 0.7
111 0.73
112 0.72
113 0.69
114 0.66
115 0.67
116 0.61
117 0.53
118 0.42
119 0.33
120 0.25
121 0.19
122 0.14
123 0.11
124 0.12
125 0.11
126 0.11
127 0.11
128 0.09
129 0.08
130 0.07
131 0.07
132 0.05
133 0.06
134 0.06
135 0.09
136 0.1
137 0.11
138 0.15
139 0.21
140 0.28
141 0.32
142 0.4
143 0.41
144 0.43
145 0.5
146 0.48
147 0.49
148 0.47
149 0.5
150 0.49
151 0.53
152 0.51
153 0.44
154 0.43
155 0.39
156 0.33
157 0.27
158 0.22
159 0.15
160 0.13
161 0.12
162 0.11
163 0.08
164 0.07
165 0.07
166 0.05
167 0.04
168 0.08
169 0.09
170 0.11
171 0.2
172 0.28
173 0.38
174 0.48
175 0.58
176 0.65
177 0.76
178 0.84
179 0.84
180 0.88
181 0.83
182 0.81
183 0.73
184 0.68
185 0.59
186 0.55
187 0.49
188 0.43
189 0.39
190 0.34
191 0.36
192 0.33
193 0.31
194 0.25
195 0.25
196 0.22
197 0.23
198 0.24
199 0.21
200 0.23
201 0.23
202 0.25
203 0.24
204 0.24
205 0.26
206 0.24
207 0.24
208 0.23
209 0.27
210 0.29
211 0.28
212 0.26
213 0.26
214 0.24
215 0.23
216 0.2
217 0.16
218 0.12
219 0.14
220 0.16
221 0.12
222 0.16
223 0.19
224 0.24
225 0.28
226 0.32
227 0.37
228 0.43
229 0.52
230 0.53
231 0.6
232 0.61
233 0.6
234 0.64
235 0.63
236 0.63
237 0.62
238 0.67
239 0.64
240 0.66
241 0.71
242 0.74