FuNGI

T0M8T1

Protein Details

Accession

T0M8T1

Localization Confidence

Medium

Confidence Score

12.3

NoLS Segment(s)

Position	Sequence	Protein Nature
457-479	KVKFILGNKKRLKHNPEKIDELC	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 20, pero 3, mito 2.5, cyto_mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR043502 DNA/RNA_pol_sf IPR043128 Rev_trsase/Diguanyl_cyclase IPR000477 RT_dom
Gene Ontology	GO:0004519 F:endonuclease activity GO:0003964 F:RNA-directed DNA polymerase activity
Pfam	View protein in Pfam PF00078 RVT_1
PROSITE	View protein in PROSITE PS50878 RT_POL

Amino Acid Sequences

MCFIDFEKAYDNVSHELLFKKLEKLNIPKYLINTIKDIYKNTTMQVKIAGETSSGYSYRKGVRQGCPCSPMLFNIFINDIFEGIEGVLIPKSNTKVPGLMFADDIIVFGNNLNDLASKVRKISKWAVDNRMRINCRKSGVLEWSVHSDAPVNRSLLSIPTDFGDIEEVTEYRYLGVLITRNTLEEHIVNDAAMRGKKALDTLMPKLVSNCIPITFKAILVKCVLVPTLMYGSELWGMSSTRAGKINRILRKSLRLIFKRVLVPLDRLMDEFKIERIHIQAALSRYRTYNKWKHNKTIISDIISINPKERKTTWCSRTQRWLKRFVGNDYETSDSRLITAKIIDVLRSRRTLNSSVAASIADKYGILDSQIKYVLQKVNNRKIRTYTRLRCNLVKWSTRMAASNRIPILYKNRCYLCDGPLENLEHCLIECPLLTETRNQYAEKLRILQCTITSNQDKVKFILGNKKRLKHNPEKIDELCTCIEFVNKIIVNRAILIQNKLCDINHNNQTNE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.21
3	0.22
4	0.22
5	0.24
6	0.23
7	0.28
8	0.3
9	0.35
10	0.41
11	0.48
12	0.55
13	0.6
14	0.62
15	0.58
16	0.57
17	0.61
18	0.57
19	0.5
20	0.45
21	0.38
22	0.41
23	0.4
24	0.4
25	0.37
26	0.38
27	0.37
28	0.37
29	0.43
30	0.37
31	0.35
32	0.38
33	0.33
34	0.27
35	0.28
36	0.25
37	0.17
38	0.18
39	0.19
40	0.16
41	0.16
42	0.16
43	0.16
44	0.2
45	0.26
46	0.29
47	0.35
48	0.4
49	0.48
50	0.57
51	0.63
52	0.64
53	0.63
54	0.59
55	0.54
56	0.47
57	0.42
58	0.36
59	0.31
60	0.26
61	0.23
62	0.23
63	0.2
64	0.2
65	0.17
66	0.13
67	0.1
68	0.09
69	0.08
70	0.06
71	0.06
72	0.05
73	0.06
74	0.06
75	0.06
76	0.07
77	0.1
78	0.12
79	0.15
80	0.18
81	0.18
82	0.21
83	0.22
84	0.29
85	0.29
86	0.27
87	0.24
88	0.22
89	0.22
90	0.18
91	0.17
92	0.09
93	0.07
94	0.06
95	0.06
96	0.06
97	0.05
98	0.05
99	0.06
100	0.05
101	0.06
102	0.11
103	0.13
104	0.14
105	0.17
106	0.23
107	0.25
108	0.31
109	0.38
110	0.42
111	0.49
112	0.55
113	0.62
114	0.63
115	0.68
116	0.68
117	0.69
118	0.65
119	0.61
120	0.59
121	0.53
122	0.48
123	0.45
124	0.41
125	0.37
126	0.39
127	0.38
128	0.35
129	0.32
130	0.34
131	0.32
132	0.29
133	0.24
134	0.23
135	0.19
136	0.2
137	0.22
138	0.17
139	0.17
140	0.17
141	0.18
142	0.15
143	0.17
144	0.14
145	0.12
146	0.12
147	0.12
148	0.11
149	0.11
150	0.11
151	0.08
152	0.08
153	0.08
154	0.08
155	0.08
156	0.08
157	0.08
158	0.06
159	0.06
160	0.06
161	0.05
162	0.07
163	0.09
164	0.1
165	0.12
166	0.12
167	0.12
168	0.13
169	0.13
170	0.13
171	0.1
172	0.11
173	0.1
174	0.1
175	0.09
176	0.09
177	0.09
178	0.11
179	0.11
180	0.1
181	0.09
182	0.1
183	0.1
184	0.11
185	0.11
186	0.12
187	0.16
188	0.18
189	0.22
190	0.22
191	0.22
192	0.22
193	0.23
194	0.2
195	0.18
196	0.16
197	0.13
198	0.14
199	0.14
200	0.18
201	0.16
202	0.16
203	0.19
204	0.19
205	0.18
206	0.18
207	0.18
208	0.14
209	0.14
210	0.13
211	0.07
212	0.07
213	0.06
214	0.07
215	0.06
216	0.06
217	0.06
218	0.06
219	0.08
220	0.08
221	0.07
222	0.06
223	0.07
224	0.06
225	0.09
226	0.09
227	0.09
228	0.14
229	0.15
230	0.17
231	0.23
232	0.31
233	0.35
234	0.36
235	0.38
236	0.36
237	0.41
238	0.43
239	0.42
240	0.43
241	0.4
242	0.42
243	0.41
244	0.42
245	0.39
246	0.35
247	0.32
248	0.24
249	0.24
250	0.22
251	0.22
252	0.17
253	0.16
254	0.16
255	0.13
256	0.13
257	0.11
258	0.1
259	0.09
260	0.09
261	0.09
262	0.1
263	0.11
264	0.11
265	0.11
266	0.12
267	0.13
268	0.17
269	0.17
270	0.16
271	0.17
272	0.19
273	0.22
274	0.29
275	0.35
276	0.42
277	0.52
278	0.56
279	0.63
280	0.68
281	0.7
282	0.63
283	0.63
284	0.56
285	0.48
286	0.45
287	0.37
288	0.33
289	0.31
290	0.28
291	0.23
292	0.25
293	0.22
294	0.23
295	0.25
296	0.26
297	0.31
298	0.42
299	0.43
300	0.49
301	0.55
302	0.57
303	0.66
304	0.7
305	0.73
306	0.67
307	0.72
308	0.66
309	0.67
310	0.65
311	0.59
312	0.57
313	0.49
314	0.45
315	0.38
316	0.37
317	0.3
318	0.3
319	0.25
320	0.17
321	0.16
322	0.17
323	0.14
324	0.12
325	0.12
326	0.1
327	0.13
328	0.14
329	0.15
330	0.17
331	0.21
332	0.23
333	0.25
334	0.26
335	0.25
336	0.29
337	0.31
338	0.3
339	0.3
340	0.27
341	0.25
342	0.24
343	0.21
344	0.17
345	0.15
346	0.12
347	0.08
348	0.06
349	0.07
350	0.07
351	0.07
352	0.08
353	0.12
354	0.12
355	0.14
356	0.16
357	0.15
358	0.15
359	0.2
360	0.25
361	0.25
362	0.34
363	0.42
364	0.51
365	0.59
366	0.61
367	0.59
368	0.61
369	0.64
370	0.64
371	0.65
372	0.65
373	0.67
374	0.74
375	0.75
376	0.72
377	0.67
378	0.68
379	0.64
380	0.61
381	0.53
382	0.5
383	0.48
384	0.45
385	0.46
386	0.4
387	0.42
388	0.39
389	0.43
390	0.38
391	0.36
392	0.35
393	0.34
394	0.4
395	0.4
396	0.41
397	0.41
398	0.43
399	0.44
400	0.49
401	0.49
402	0.42
403	0.42
404	0.39
405	0.35
406	0.37
407	0.37
408	0.31
409	0.3
410	0.27
411	0.19
412	0.17
413	0.16
414	0.12
415	0.1
416	0.1
417	0.1
418	0.11
419	0.13
420	0.14
421	0.18
422	0.23
423	0.29
424	0.32
425	0.3
426	0.33
427	0.4
428	0.43
429	0.41
430	0.44
431	0.41
432	0.42
433	0.44
434	0.42
435	0.36
436	0.36
437	0.34
438	0.35
439	0.34
440	0.33
441	0.38
442	0.42
443	0.42
444	0.38
445	0.42
446	0.38
447	0.39
448	0.47
449	0.48
450	0.53
451	0.59
452	0.65
453	0.69
454	0.74
455	0.8
456	0.8
457	0.83
458	0.83
459	0.81
460	0.82
461	0.74
462	0.72
463	0.62
464	0.56
465	0.47
466	0.36
467	0.31
468	0.23
469	0.24
470	0.17
471	0.17
472	0.21
473	0.22
474	0.22
475	0.26
476	0.28
477	0.27
478	0.27
479	0.29
480	0.26
481	0.28
482	0.33
483	0.32
484	0.31
485	0.33
486	0.34
487	0.31
488	0.33
489	0.35
490	0.39
491	0.45

T0M8T1

3D AlphaFold-predicted Structure Viewer