Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0KY07

Protein Details
Accession T0KY07    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
102-128KEIIKNRKIKNIKKRIRDLKRRTFVDSBasic
NLS Segment(s)
PositionSequence
98-123KEERKEIIKNRKIKNIKKRIRDLKRR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009061  DNA-bd_dom_put_sf  
IPR000465  XPA  
IPR022656  XPA_C  
IPR037129  XPA_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF05181  XPA_C  
Amino Acid Sequences MDTNKCSFCDTPYIDTEMYTTFNIKTCRDCKRSIKLITKTTALKEYLLTNEDLNKLNFITRPNPHKGNWHDMCLYMEEEVKKVSMNKFENEETLEKVKEERKEIIKNRKIKNIKKRIRDLKRRTFVDSVCIKEEHVHEFVGTDGNKVCSCGMEIEQEEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.31
4 0.23
5 0.21
6 0.17
7 0.16
8 0.13
9 0.18
10 0.21
11 0.21
12 0.28
13 0.32
14 0.41
15 0.45
16 0.51
17 0.55
18 0.62
19 0.69
20 0.71
21 0.74
22 0.72
23 0.74
24 0.69
25 0.65
26 0.58
27 0.52
28 0.47
29 0.38
30 0.31
31 0.25
32 0.24
33 0.22
34 0.2
35 0.18
36 0.14
37 0.16
38 0.18
39 0.18
40 0.17
41 0.15
42 0.14
43 0.14
44 0.15
45 0.15
46 0.19
47 0.23
48 0.29
49 0.34
50 0.37
51 0.36
52 0.43
53 0.45
54 0.49
55 0.45
56 0.42
57 0.37
58 0.35
59 0.34
60 0.27
61 0.23
62 0.13
63 0.13
64 0.1
65 0.1
66 0.1
67 0.09
68 0.08
69 0.1
70 0.12
71 0.17
72 0.19
73 0.2
74 0.24
75 0.24
76 0.25
77 0.25
78 0.24
79 0.19
80 0.19
81 0.18
82 0.15
83 0.17
84 0.21
85 0.21
86 0.23
87 0.26
88 0.31
89 0.4
90 0.48
91 0.57
92 0.59
93 0.65
94 0.67
95 0.72
96 0.75
97 0.75
98 0.77
99 0.78
100 0.79
101 0.8
102 0.85
103 0.86
104 0.88
105 0.9
106 0.89
107 0.89
108 0.9
109 0.83
110 0.78
111 0.73
112 0.62
113 0.6
114 0.55
115 0.48
116 0.42
117 0.39
118 0.33
119 0.32
120 0.33
121 0.29
122 0.25
123 0.21
124 0.18
125 0.18
126 0.18
127 0.2
128 0.18
129 0.15
130 0.15
131 0.18
132 0.18
133 0.19
134 0.18
135 0.14
136 0.15
137 0.16
138 0.16
139 0.2