Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MET7

Protein Details
Accession T0MET7    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-57QKKVHMSNKKYKKKTNLTKEVVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, mito 7
Family & Domain DBs
Amino Acid Sequences MFQINSSINLIEYYREEIYTYKKLLKLARCKITNLQKKVHMSNKKYKKKTNLTKEVVSKITKGSSAVLNFSNSSVNSNRLTIPKNFNPYKNFTENKIIIYLISFKNYLVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.16
5 0.22
6 0.26
7 0.27
8 0.27
9 0.28
10 0.33
11 0.39
12 0.46
13 0.5
14 0.54
15 0.6
16 0.57
17 0.59
18 0.62
19 0.67
20 0.67
21 0.62
22 0.58
23 0.55
24 0.58
25 0.61
26 0.62
27 0.61
28 0.58
29 0.63
30 0.69
31 0.73
32 0.75
33 0.75
34 0.76
35 0.78
36 0.82
37 0.82
38 0.81
39 0.76
40 0.74
41 0.71
42 0.64
43 0.57
44 0.47
45 0.37
46 0.28
47 0.24
48 0.19
49 0.16
50 0.14
51 0.13
52 0.13
53 0.14
54 0.14
55 0.15
56 0.14
57 0.15
58 0.15
59 0.11
60 0.14
61 0.14
62 0.16
63 0.16
64 0.17
65 0.19
66 0.21
67 0.24
68 0.26
69 0.33
70 0.36
71 0.44
72 0.47
73 0.51
74 0.52
75 0.56
76 0.57
77 0.58
78 0.54
79 0.49
80 0.54
81 0.5
82 0.47
83 0.42
84 0.35
85 0.26
86 0.26
87 0.27
88 0.19
89 0.21
90 0.19