Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0LCA9

Protein Details
Accession T0LCA9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-96QKGSTTLPRANKKRRGGEKRIKMKGRTNNKKSLKNEHydrophilic
NLS Segment(s)
PositionSequence
47-94MKRKSARFWGKAPGQKGSTTLPRANKKRRGGEKRIKMKGRTNNKKSLK
Subcellular Location(s) mito 16.5, mito_nucl 12.333, nucl 7, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MRIVALQWSRSVQEKVEKCGGSFFNLDQLFKVAPNIENIVLIQGDRMKRKSARFWGKAPGQKGSTTLPRANKKRRGGEKRIKMKGRTNNKKSLKNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.43
4 0.41
5 0.37
6 0.41
7 0.38
8 0.32
9 0.3
10 0.24
11 0.25
12 0.25
13 0.25
14 0.2
15 0.2
16 0.17
17 0.16
18 0.17
19 0.1
20 0.1
21 0.12
22 0.13
23 0.11
24 0.11
25 0.11
26 0.1
27 0.09
28 0.08
29 0.07
30 0.08
31 0.1
32 0.13
33 0.15
34 0.18
35 0.22
36 0.25
37 0.32
38 0.39
39 0.47
40 0.48
41 0.5
42 0.54
43 0.57
44 0.59
45 0.54
46 0.48
47 0.4
48 0.36
49 0.35
50 0.31
51 0.31
52 0.31
53 0.34
54 0.38
55 0.46
56 0.55
57 0.63
58 0.68
59 0.7
60 0.76
61 0.82
62 0.83
63 0.85
64 0.86
65 0.87
66 0.88
67 0.9
68 0.87
69 0.83
70 0.82
71 0.82
72 0.82
73 0.83
74 0.8
75 0.81
76 0.82