Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MEQ2

Protein Details
Accession T0MEQ2    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
153-184YKKAREGSKSTKGKQKRKKYSNSKEENHRSAHBasic
NLS Segment(s)
PositionSequence
154-173KKAREGSKSTKGKQKRKKYS
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013760  Topo_IIA-like_dom_sf  
IPR013757  Topo_IIA_A_a_sf  
IPR002205  Topo_IIA_dom_A  
Gene Ontology GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0003918  F:DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity  
GO:0006265  P:DNA topological change  
Pfam View protein in Pfam  
PF00521  DNA_topoisoIV  
Amino Acid Sequences MVCFDKNLKIKKYDTPEDIIKDFYYVRLTYYMKRKEKLLAVLKENMLKLENKVRFIKEVVNDELIINKRKKSDLIDELKFKEYTEFDNFSYLLSMEILSLTEERIDKLNKELFNKIEEYNVLQGKTPKDLWREDLYEFEIAYDKVVEYEEEVYKKAREGSKSTKGKQKRKKYSNSKEENHRSAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.57
4 0.56
5 0.54
6 0.47
7 0.38
8 0.32
9 0.28
10 0.23
11 0.21
12 0.17
13 0.17
14 0.2
15 0.22
16 0.27
17 0.37
18 0.45
19 0.47
20 0.49
21 0.5
22 0.51
23 0.54
24 0.57
25 0.56
26 0.53
27 0.5
28 0.53
29 0.52
30 0.5
31 0.44
32 0.36
33 0.28
34 0.22
35 0.21
36 0.26
37 0.27
38 0.28
39 0.32
40 0.32
41 0.32
42 0.33
43 0.35
44 0.3
45 0.32
46 0.3
47 0.28
48 0.27
49 0.24
50 0.27
51 0.25
52 0.27
53 0.23
54 0.23
55 0.24
56 0.24
57 0.27
58 0.26
59 0.31
60 0.35
61 0.4
62 0.42
63 0.44
64 0.45
65 0.46
66 0.41
67 0.34
68 0.27
69 0.2
70 0.2
71 0.21
72 0.21
73 0.18
74 0.2
75 0.2
76 0.17
77 0.17
78 0.12
79 0.08
80 0.06
81 0.06
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.06
91 0.09
92 0.1
93 0.1
94 0.14
95 0.19
96 0.21
97 0.24
98 0.26
99 0.25
100 0.26
101 0.28
102 0.24
103 0.21
104 0.18
105 0.18
106 0.19
107 0.2
108 0.18
109 0.17
110 0.2
111 0.2
112 0.23
113 0.24
114 0.24
115 0.26
116 0.28
117 0.32
118 0.33
119 0.35
120 0.32
121 0.31
122 0.29
123 0.25
124 0.23
125 0.19
126 0.15
127 0.12
128 0.12
129 0.1
130 0.08
131 0.07
132 0.08
133 0.08
134 0.07
135 0.11
136 0.14
137 0.15
138 0.16
139 0.18
140 0.18
141 0.2
142 0.24
143 0.26
144 0.28
145 0.34
146 0.43
147 0.51
148 0.6
149 0.64
150 0.68
151 0.73
152 0.79
153 0.82
154 0.84
155 0.85
156 0.86
157 0.91
158 0.93
159 0.94
160 0.94
161 0.94
162 0.91
163 0.91
164 0.9