Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MEM5

Protein Details
Accession T0MEM5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-121ATNCRKKGCGSKDLRPKKPLKVVKKBasic
NLS Segment(s)
PositionSequence
109-121DLRPKKPLKVVKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
Amino Acid Sequences MQLICNKKIYSVDENTTISQFKNMICEEDCVLTYNAKILEDNSIIKCHNFKNMSEIVLTVRCLGGGNALAENDRELANQRNKRLICRRCNVRNSVNATNCRKKGCGSKDLRPKKPLKVVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.38
4 0.33
5 0.26
6 0.22
7 0.2
8 0.16
9 0.19
10 0.18
11 0.2
12 0.2
13 0.21
14 0.2
15 0.2
16 0.2
17 0.17
18 0.17
19 0.14
20 0.13
21 0.13
22 0.13
23 0.11
24 0.11
25 0.09
26 0.12
27 0.13
28 0.16
29 0.14
30 0.15
31 0.15
32 0.16
33 0.18
34 0.16
35 0.22
36 0.21
37 0.2
38 0.24
39 0.25
40 0.25
41 0.22
42 0.22
43 0.16
44 0.15
45 0.15
46 0.09
47 0.08
48 0.07
49 0.07
50 0.06
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.07
63 0.15
64 0.24
65 0.29
66 0.31
67 0.38
68 0.39
69 0.47
70 0.55
71 0.57
72 0.57
73 0.62
74 0.7
75 0.72
76 0.78
77 0.76
78 0.73
79 0.71
80 0.69
81 0.69
82 0.66
83 0.65
84 0.67
85 0.69
86 0.66
87 0.62
88 0.56
89 0.51
90 0.55
91 0.54
92 0.56
93 0.54
94 0.6
95 0.68
96 0.77
97 0.81
98 0.8
99 0.79
100 0.78
101 0.81