Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0KY51

Protein Details
Accession T0KY51    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-35NDFYRTLKWIFKNTRRPSFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004527  F:exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF00929  RNase_T  
Amino Acid Sequences MYNKNKNFDLKRFKLNDFYRTLKWIFKNTRRPSFLPFKNYNKPLSVNFIFIKDFVKCYLKLPTNYKLKLNENFNFNDLHFNLTREINIRELDPSYDVISPENVNFVSSIQMEQLYDNKIFINSDINLKCPNKNSTFNNNSNYFLVSLDIEMVTTVNGKNIGRITILDHLGNNIYDQYVKPLDLVVNYETEFSGLTKENVSNGITIDQMKSDISCIIGKNTYILGHGLENDLTVLRMYHSKLIDTSYLFLSTSSRRVSLKQLSNVYLKTRIHDGCHCSEEDAKMCLLLLSIKIQEMLIAKNEMSPKIDINGKIITIKSLNEALKNRNSDLILWYSTVEDTKEYIDKYKNHRTLTFFFYEEENKIKFEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.66
4 0.62
5 0.62
6 0.55
7 0.54
8 0.53
9 0.51
10 0.5
11 0.53
12 0.57
13 0.61
14 0.69
15 0.73
16 0.8
17 0.79
18 0.77
19 0.75
20 0.76
21 0.73
22 0.72
23 0.71
24 0.69
25 0.73
26 0.75
27 0.71
28 0.64
29 0.6
30 0.53
31 0.54
32 0.46
33 0.41
34 0.37
35 0.35
36 0.32
37 0.29
38 0.29
39 0.21
40 0.21
41 0.2
42 0.23
43 0.21
44 0.23
45 0.31
46 0.36
47 0.41
48 0.45
49 0.5
50 0.56
51 0.58
52 0.61
53 0.58
54 0.58
55 0.59
56 0.62
57 0.57
58 0.52
59 0.51
60 0.47
61 0.42
62 0.35
63 0.35
64 0.27
65 0.27
66 0.23
67 0.22
68 0.23
69 0.22
70 0.23
71 0.19
72 0.2
73 0.18
74 0.18
75 0.17
76 0.17
77 0.17
78 0.17
79 0.15
80 0.15
81 0.14
82 0.15
83 0.15
84 0.13
85 0.14
86 0.14
87 0.13
88 0.13
89 0.11
90 0.1
91 0.1
92 0.09
93 0.1
94 0.09
95 0.1
96 0.08
97 0.09
98 0.09
99 0.1
100 0.12
101 0.13
102 0.12
103 0.12
104 0.12
105 0.12
106 0.12
107 0.12
108 0.13
109 0.11
110 0.18
111 0.18
112 0.2
113 0.26
114 0.27
115 0.3
116 0.3
117 0.35
118 0.33
119 0.39
120 0.44
121 0.48
122 0.54
123 0.57
124 0.58
125 0.54
126 0.51
127 0.45
128 0.39
129 0.29
130 0.21
131 0.16
132 0.11
133 0.09
134 0.07
135 0.06
136 0.05
137 0.05
138 0.05
139 0.04
140 0.05
141 0.05
142 0.05
143 0.07
144 0.07
145 0.09
146 0.1
147 0.1
148 0.1
149 0.1
150 0.12
151 0.13
152 0.15
153 0.13
154 0.12
155 0.12
156 0.13
157 0.12
158 0.1
159 0.06
160 0.05
161 0.06
162 0.06
163 0.08
164 0.08
165 0.08
166 0.08
167 0.09
168 0.09
169 0.09
170 0.1
171 0.08
172 0.08
173 0.08
174 0.09
175 0.08
176 0.08
177 0.07
178 0.06
179 0.07
180 0.07
181 0.07
182 0.08
183 0.08
184 0.09
185 0.1
186 0.11
187 0.09
188 0.09
189 0.09
190 0.08
191 0.09
192 0.09
193 0.07
194 0.07
195 0.07
196 0.07
197 0.07
198 0.06
199 0.07
200 0.08
201 0.09
202 0.1
203 0.11
204 0.11
205 0.11
206 0.11
207 0.1
208 0.09
209 0.09
210 0.08
211 0.08
212 0.08
213 0.08
214 0.07
215 0.07
216 0.06
217 0.06
218 0.05
219 0.05
220 0.05
221 0.05
222 0.07
223 0.08
224 0.13
225 0.13
226 0.14
227 0.14
228 0.16
229 0.18
230 0.16
231 0.17
232 0.13
233 0.13
234 0.13
235 0.12
236 0.13
237 0.12
238 0.16
239 0.16
240 0.17
241 0.18
242 0.2
243 0.27
244 0.34
245 0.39
246 0.41
247 0.44
248 0.45
249 0.48
250 0.48
251 0.43
252 0.41
253 0.34
254 0.3
255 0.32
256 0.31
257 0.31
258 0.35
259 0.38
260 0.35
261 0.37
262 0.36
263 0.31
264 0.32
265 0.3
266 0.27
267 0.23
268 0.18
269 0.16
270 0.15
271 0.13
272 0.11
273 0.09
274 0.08
275 0.09
276 0.1
277 0.1
278 0.11
279 0.1
280 0.12
281 0.13
282 0.13
283 0.13
284 0.14
285 0.14
286 0.17
287 0.2
288 0.19
289 0.2
290 0.2
291 0.18
292 0.21
293 0.26
294 0.23
295 0.24
296 0.24
297 0.23
298 0.24
299 0.23
300 0.22
301 0.19
302 0.18
303 0.18
304 0.23
305 0.24
306 0.28
307 0.32
308 0.36
309 0.42
310 0.45
311 0.43
312 0.41
313 0.4
314 0.35
315 0.35
316 0.32
317 0.26
318 0.23
319 0.22
320 0.19
321 0.19
322 0.19
323 0.15
324 0.12
325 0.12
326 0.15
327 0.18
328 0.19
329 0.24
330 0.3
331 0.37
332 0.44
333 0.54
334 0.58
335 0.6
336 0.63
337 0.64
338 0.63
339 0.62
340 0.58
341 0.48
342 0.42
343 0.41
344 0.4
345 0.36
346 0.37
347 0.31