Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MES1

Protein Details
Accession T0MES1   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-40VTKLNIEKIKPKHKKNNLRVQEKKFAKHydrophilic
71-92FLKRRLGSNKRAQKKMKELQIAHydrophilic
NLS Segment(s)
PositionSequence
21-31KIKPKHKKNNL
74-85RRLGSNKRAQKK
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MRRGLKKIQVHHQVTKLNIEKIKPKHKKNNLRVQEKKFAKELVREISGYAPYESKAISILKAKDTARAMIFLKRRLGSNKRAQKKMKELQIAATD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.55
4 0.51
5 0.47
6 0.43
7 0.45
8 0.49
9 0.59
10 0.59
11 0.64
12 0.69
13 0.77
14 0.86
15 0.87
16 0.9
17 0.88
18 0.9
19 0.89
20 0.85
21 0.84
22 0.77
23 0.69
24 0.6
25 0.54
26 0.46
27 0.41
28 0.38
29 0.32
30 0.3
31 0.27
32 0.25
33 0.23
34 0.21
35 0.17
36 0.14
37 0.1
38 0.08
39 0.09
40 0.08
41 0.07
42 0.08
43 0.08
44 0.09
45 0.13
46 0.15
47 0.16
48 0.21
49 0.21
50 0.24
51 0.25
52 0.26
53 0.22
54 0.24
55 0.24
56 0.26
57 0.3
58 0.29
59 0.33
60 0.31
61 0.35
62 0.4
63 0.46
64 0.48
65 0.55
66 0.61
67 0.65
68 0.73
69 0.77
70 0.78
71 0.82
72 0.82
73 0.8
74 0.79
75 0.71