Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MFL5

Protein Details
Accession T0MFL5   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MARQKTQQAHKQKNKRRINSSRLKKEGTHydrophilic
68-89NALSTHKKSKVHKKRVKELGDVHydrophilic
NLS Segment(s)
PositionSequence
13-18KNKRRI
75-82KSKVHKKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MARQKTQQAHKQKNKRRINSSRLKKEGTLGLDQIQRNILNNIIPIDDEFNKESKYYCIECDRFFISDNALSTHKKSKVHKKRVKELGDVIHTQKHAEMAVGLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.9
4 0.89
5 0.88
6 0.88
7 0.89
8 0.89
9 0.84
10 0.78
11 0.68
12 0.62
13 0.57
14 0.5
15 0.42
16 0.32
17 0.31
18 0.33
19 0.32
20 0.28
21 0.25
22 0.21
23 0.2
24 0.19
25 0.16
26 0.11
27 0.11
28 0.11
29 0.09
30 0.09
31 0.08
32 0.1
33 0.1
34 0.11
35 0.11
36 0.12
37 0.12
38 0.12
39 0.13
40 0.11
41 0.14
42 0.13
43 0.15
44 0.21
45 0.23
46 0.23
47 0.26
48 0.26
49 0.23
50 0.23
51 0.21
52 0.16
53 0.16
54 0.16
55 0.15
56 0.16
57 0.16
58 0.18
59 0.25
60 0.27
61 0.32
62 0.39
63 0.49
64 0.58
65 0.68
66 0.74
67 0.76
68 0.82
69 0.86
70 0.83
71 0.78
72 0.73
73 0.7
74 0.67
75 0.61
76 0.53
77 0.48
78 0.42
79 0.37
80 0.31
81 0.24
82 0.19
83 0.16