Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L3U4

Protein Details
Accession T0L3U4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
246-265KPKIDKPKVKVISKKQQLSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
Amino Acid Sequences MSSQVFEYIKECVNLSKLKENETTWSKIDKLFLNLTTSLNNKDDSEMFIKSCNELLCRSIISDRSKLSGTSLVLSKKISVILKDDLKLHCILPNVLKVCGRSNKVVYSRGHDTIEHLSKNVDLSPYYKILYEHYNSINKNIRLGVIKGITICDDKSKFIKIIEKAKTDQFIEIRNLIKSCSINHTQKFEPRPILKKELSPQKQIINHIQPKHSPYKKSIKLESESNLVCEKITELEKQVKLITNNKPKIDKPKVKVISKKQQLSVKKEVKDLSDDLTPRKLDKYLSKYRNIYGNILEENKKDEINFMIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.36
4 0.35
5 0.39
6 0.43
7 0.42
8 0.45
9 0.46
10 0.46
11 0.4
12 0.42
13 0.39
14 0.36
15 0.39
16 0.35
17 0.34
18 0.34
19 0.33
20 0.33
21 0.33
22 0.31
23 0.31
24 0.29
25 0.28
26 0.25
27 0.25
28 0.22
29 0.23
30 0.22
31 0.23
32 0.24
33 0.22
34 0.21
35 0.23
36 0.23
37 0.21
38 0.23
39 0.2
40 0.19
41 0.19
42 0.2
43 0.18
44 0.18
45 0.18
46 0.19
47 0.23
48 0.26
49 0.29
50 0.29
51 0.3
52 0.3
53 0.28
54 0.27
55 0.26
56 0.21
57 0.2
58 0.23
59 0.22
60 0.22
61 0.23
62 0.21
63 0.17
64 0.21
65 0.19
66 0.17
67 0.19
68 0.24
69 0.27
70 0.28
71 0.31
72 0.27
73 0.28
74 0.28
75 0.24
76 0.21
77 0.19
78 0.19
79 0.18
80 0.23
81 0.22
82 0.22
83 0.23
84 0.22
85 0.27
86 0.31
87 0.31
88 0.29
89 0.31
90 0.35
91 0.38
92 0.43
93 0.38
94 0.38
95 0.39
96 0.38
97 0.37
98 0.3
99 0.3
100 0.3
101 0.33
102 0.27
103 0.23
104 0.21
105 0.2
106 0.2
107 0.18
108 0.12
109 0.08
110 0.1
111 0.12
112 0.13
113 0.13
114 0.13
115 0.13
116 0.14
117 0.17
118 0.17
119 0.18
120 0.2
121 0.25
122 0.24
123 0.29
124 0.34
125 0.3
126 0.3
127 0.27
128 0.25
129 0.22
130 0.22
131 0.2
132 0.14
133 0.14
134 0.13
135 0.13
136 0.12
137 0.11
138 0.1
139 0.11
140 0.11
141 0.12
142 0.14
143 0.15
144 0.15
145 0.16
146 0.22
147 0.22
148 0.31
149 0.34
150 0.36
151 0.36
152 0.37
153 0.38
154 0.32
155 0.31
156 0.23
157 0.21
158 0.2
159 0.21
160 0.2
161 0.19
162 0.19
163 0.17
164 0.18
165 0.15
166 0.15
167 0.17
168 0.23
169 0.28
170 0.3
171 0.34
172 0.34
173 0.4
174 0.42
175 0.41
176 0.42
177 0.42
178 0.46
179 0.47
180 0.51
181 0.47
182 0.47
183 0.51
184 0.55
185 0.53
186 0.52
187 0.5
188 0.49
189 0.51
190 0.51
191 0.51
192 0.5
193 0.52
194 0.51
195 0.51
196 0.47
197 0.49
198 0.55
199 0.53
200 0.46
201 0.46
202 0.54
203 0.59
204 0.63
205 0.64
206 0.6
207 0.58
208 0.59
209 0.55
210 0.5
211 0.42
212 0.37
213 0.31
214 0.25
215 0.21
216 0.17
217 0.15
218 0.12
219 0.14
220 0.14
221 0.17
222 0.25
223 0.25
224 0.27
225 0.29
226 0.3
227 0.31
228 0.38
229 0.44
230 0.47
231 0.52
232 0.56
233 0.58
234 0.58
235 0.65
236 0.68
237 0.68
238 0.62
239 0.67
240 0.71
241 0.75
242 0.8
243 0.79
244 0.79
245 0.79
246 0.8
247 0.76
248 0.76
249 0.76
250 0.75
251 0.75
252 0.72
253 0.66
254 0.65
255 0.61
256 0.56
257 0.52
258 0.45
259 0.38
260 0.36
261 0.35
262 0.32
263 0.35
264 0.34
265 0.31
266 0.32
267 0.3
268 0.3
269 0.38
270 0.43
271 0.49
272 0.55
273 0.61
274 0.63
275 0.65
276 0.67
277 0.61
278 0.56
279 0.49
280 0.46
281 0.43
282 0.44
283 0.43
284 0.36
285 0.37
286 0.35
287 0.32
288 0.27
289 0.25