Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L7K4

Protein Details
Accession T0L7K4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-78NNFDLKKPLNKKWRGKKDKELEILCHydrophilic
NLS Segment(s)
PositionSequence
60-70KPLNKKWRGKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003226  Met-dep_prot_hydro  
Pfam View protein in Pfam  
PF03690  UPF0160  
Amino Acid Sequences MIILNIDDYILISNEYYDINLILEIEAIYGKNILYMVYPYESEYKIRAINISSNNFDLKKPLNKKWRGKKDKELEILCDGGVFVHSTGFIGSNKTKEGAIKMCRESYFSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.07
5 0.06
6 0.06
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.07
24 0.08
25 0.08
26 0.09
27 0.12
28 0.12
29 0.13
30 0.13
31 0.14
32 0.14
33 0.14
34 0.14
35 0.12
36 0.17
37 0.21
38 0.22
39 0.21
40 0.21
41 0.23
42 0.22
43 0.21
44 0.19
45 0.18
46 0.23
47 0.28
48 0.36
49 0.44
50 0.53
51 0.63
52 0.71
53 0.79
54 0.81
55 0.82
56 0.84
57 0.84
58 0.83
59 0.82
60 0.72
61 0.65
62 0.57
63 0.5
64 0.39
65 0.3
66 0.2
67 0.12
68 0.11
69 0.07
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.07
76 0.07
77 0.12
78 0.14
79 0.16
80 0.18
81 0.18
82 0.19
83 0.2
84 0.25
85 0.29
86 0.33
87 0.39
88 0.42
89 0.46
90 0.45