Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0L6B9

Protein Details
Accession T0L6B9    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-57MIKVRKIKKREEVKVRMKERTEVKERMKKKAKAKKKEKVIKAKVKERMKKKEKVIKABasic
118-149KEKKVIIKAKVKKIKTKKAETKKEPVKVNKLIBasic
NLS Segment(s)
PositionSequence
4-142VRKIKKREEVKVRMKERTEVKERMKKKAKAKKKEKVIKAKVKERMKKKEKVIKAVKREIKAKEVQTKEREKKGAKKVLIKVKADLKRKETKAKVEVEAKKEVIKVRETKAKVEVKEKKVIIKAKVKKIKTKKAETKKEP
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MIKVRKIKKREEVKVRMKERTEVKERMKKKAKAKKKEKVIKAKVKERMKKKEKVIKAVKREIKAKEVQTKEREKKGAKKVLIKVKADLKRKETKAKVEVEAKKEVIKVRETKAKVEVKEKKVIIKAKVKKIKTKKAETKKEPVKVNKLISYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.84
4 0.76
5 0.73
6 0.7
7 0.68
8 0.66
9 0.64
10 0.67
11 0.69
12 0.7
13 0.74
14 0.76
15 0.74
16 0.77
17 0.79
18 0.8
19 0.81
20 0.88
21 0.87
22 0.88
23 0.9
24 0.9
25 0.9
26 0.9
27 0.89
28 0.87
29 0.86
30 0.85
31 0.85
32 0.83
33 0.82
34 0.82
35 0.8
36 0.79
37 0.8
38 0.81
39 0.77
40 0.79
41 0.8
42 0.77
43 0.77
44 0.79
45 0.75
46 0.69
47 0.69
48 0.61
49 0.56
50 0.53
51 0.5
52 0.49
53 0.48
54 0.5
55 0.51
56 0.59
57 0.59
58 0.59
59 0.59
60 0.54
61 0.59
62 0.62
63 0.62
64 0.56
65 0.58
66 0.6
67 0.63
68 0.66
69 0.58
70 0.51
71 0.52
72 0.55
73 0.55
74 0.52
75 0.5
76 0.52
77 0.55
78 0.61
79 0.57
80 0.58
81 0.57
82 0.57
83 0.55
84 0.55
85 0.57
86 0.52
87 0.51
88 0.44
89 0.39
90 0.38
91 0.36
92 0.3
93 0.31
94 0.31
95 0.32
96 0.4
97 0.4
98 0.4
99 0.46
100 0.49
101 0.46
102 0.52
103 0.56
104 0.53
105 0.6
106 0.58
107 0.55
108 0.56
109 0.59
110 0.57
111 0.58
112 0.61
113 0.64
114 0.72
115 0.71
116 0.75
117 0.79
118 0.82
119 0.81
120 0.84
121 0.84
122 0.86
123 0.92
124 0.89
125 0.9
126 0.89
127 0.87
128 0.85
129 0.83
130 0.82
131 0.79
132 0.78