Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0L3Y5

Protein Details
Accession T0L3Y5    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
113-142NNPIIKKLLKNKKCVKRQLKIVRYERNPYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000889  Glutathione_peroxidase  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0004602  F:glutathione peroxidase activity  
GO:0006979  P:response to oxidative stress  
PROSITE View protein in PROSITE  
PS51355  GLUTATHIONE_PEROXID_3  
Amino Acid Sequences MSERSRESKEFYSLKADYGLKVLIFPSLQYIKDDEVDALRKMYDIITEYSDEFIIFSDVNIYGKNVHPVFKHLIKWSKGLCGSFMKWDFPKFIINDKGNLVKVYEPGDRFEVNNPIIKKLLKNKKCVKRQLKIVRYERNPYDIEDSEEEIYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.35
4 0.27
5 0.26
6 0.25
7 0.17
8 0.17
9 0.16
10 0.12
11 0.11
12 0.1
13 0.14
14 0.15
15 0.16
16 0.17
17 0.19
18 0.18
19 0.19
20 0.2
21 0.15
22 0.15
23 0.18
24 0.17
25 0.15
26 0.14
27 0.12
28 0.12
29 0.12
30 0.1
31 0.09
32 0.1
33 0.11
34 0.12
35 0.13
36 0.13
37 0.13
38 0.11
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.08
50 0.08
51 0.14
52 0.13
53 0.15
54 0.15
55 0.19
56 0.23
57 0.25
58 0.27
59 0.26
60 0.33
61 0.32
62 0.35
63 0.32
64 0.32
65 0.3
66 0.27
67 0.25
68 0.21
69 0.2
70 0.22
71 0.22
72 0.21
73 0.21
74 0.22
75 0.21
76 0.19
77 0.22
78 0.18
79 0.23
80 0.28
81 0.28
82 0.28
83 0.29
84 0.31
85 0.28
86 0.27
87 0.22
88 0.15
89 0.16
90 0.18
91 0.2
92 0.17
93 0.19
94 0.21
95 0.21
96 0.21
97 0.23
98 0.25
99 0.22
100 0.27
101 0.26
102 0.25
103 0.27
104 0.27
105 0.3
106 0.34
107 0.44
108 0.45
109 0.54
110 0.63
111 0.71
112 0.79
113 0.84
114 0.84
115 0.82
116 0.87
117 0.88
118 0.86
119 0.87
120 0.86
121 0.85
122 0.81
123 0.81
124 0.73
125 0.67
126 0.6
127 0.53
128 0.51
129 0.42
130 0.41
131 0.35
132 0.35