Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0MKA8

Protein Details
Accession T0MKA8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-106NEINKQYTCIKNKKLKKMILKISLKCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences MFEHYNTKIEELILDNKKLHTINNNLKEELNKSNNRLIDCNVELCKIKEEFNSLNINYNKLKSLNIKLENKMKKNHIQFRNEINKQYTCIKNKKLKKMILKISLKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.31
5 0.3
6 0.28
7 0.27
8 0.32
9 0.4
10 0.49
11 0.51
12 0.49
13 0.49
14 0.49
15 0.45
16 0.43
17 0.41
18 0.35
19 0.35
20 0.39
21 0.41
22 0.4
23 0.38
24 0.32
25 0.29
26 0.27
27 0.26
28 0.22
29 0.21
30 0.2
31 0.19
32 0.21
33 0.16
34 0.17
35 0.14
36 0.18
37 0.17
38 0.2
39 0.23
40 0.2
41 0.26
42 0.25
43 0.28
44 0.24
45 0.24
46 0.22
47 0.19
48 0.21
49 0.18
50 0.23
51 0.29
52 0.35
53 0.39
54 0.42
55 0.51
56 0.56
57 0.56
58 0.56
59 0.54
60 0.55
61 0.61
62 0.66
63 0.65
64 0.64
65 0.64
66 0.68
67 0.73
68 0.68
69 0.63
70 0.58
71 0.52
72 0.49
73 0.52
74 0.5
75 0.49
76 0.54
77 0.58
78 0.63
79 0.71
80 0.79
81 0.8
82 0.81
83 0.83
84 0.84
85 0.85
86 0.85