Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0MG88

Protein Details
Accession T0MG88    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
163-189NEVFKNIKIKFDKKKFDKKLYQSIIGEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8, cyto 4, pero 2, E.R. 1, cysk 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MCLSIYFLKHLIWTKNKIYNLENLSKKEHKKLTETLSTTFKHLDSIHCSHLIDILIITVQLEITDLNKCKPLVSDIIDERVQNYNKNTKKIQGLGESTNIDINNNNDYNDFVLYYFKRVHKLFNNWKRISISQLLEISLNFYKYIKFNPNVEKNNYNIVLNNNEVFKNIKIKFDKKKFDKKLYQSIIGEDNTHFFDFTFTLFIRYVFGII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.56
4 0.56
5 0.52
6 0.52
7 0.52
8 0.54
9 0.53
10 0.48
11 0.53
12 0.57
13 0.59
14 0.6
15 0.6
16 0.55
17 0.55
18 0.6
19 0.6
20 0.6
21 0.58
22 0.53
23 0.52
24 0.49
25 0.45
26 0.39
27 0.32
28 0.26
29 0.24
30 0.25
31 0.26
32 0.29
33 0.3
34 0.29
35 0.29
36 0.26
37 0.27
38 0.23
39 0.16
40 0.11
41 0.09
42 0.07
43 0.07
44 0.07
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.05
51 0.09
52 0.1
53 0.11
54 0.15
55 0.15
56 0.15
57 0.16
58 0.18
59 0.17
60 0.19
61 0.23
62 0.21
63 0.25
64 0.26
65 0.25
66 0.24
67 0.26
68 0.24
69 0.22
70 0.24
71 0.3
72 0.33
73 0.37
74 0.37
75 0.35
76 0.38
77 0.39
78 0.39
79 0.35
80 0.34
81 0.31
82 0.32
83 0.28
84 0.24
85 0.22
86 0.18
87 0.14
88 0.11
89 0.11
90 0.12
91 0.12
92 0.12
93 0.1
94 0.11
95 0.11
96 0.1
97 0.09
98 0.06
99 0.09
100 0.09
101 0.11
102 0.15
103 0.15
104 0.21
105 0.21
106 0.26
107 0.3
108 0.4
109 0.49
110 0.54
111 0.63
112 0.59
113 0.61
114 0.59
115 0.53
116 0.47
117 0.42
118 0.33
119 0.27
120 0.27
121 0.25
122 0.22
123 0.21
124 0.19
125 0.15
126 0.14
127 0.1
128 0.1
129 0.11
130 0.12
131 0.17
132 0.21
133 0.23
134 0.29
135 0.38
136 0.47
137 0.51
138 0.56
139 0.53
140 0.48
141 0.52
142 0.47
143 0.38
144 0.31
145 0.28
146 0.26
147 0.25
148 0.25
149 0.2
150 0.18
151 0.19
152 0.19
153 0.18
154 0.24
155 0.24
156 0.31
157 0.36
158 0.45
159 0.55
160 0.62
161 0.71
162 0.72
163 0.81
164 0.83
165 0.86
166 0.88
167 0.85
168 0.87
169 0.82
170 0.8
171 0.7
172 0.64
173 0.58
174 0.49
175 0.42
176 0.32
177 0.27
178 0.23
179 0.22
180 0.19
181 0.14
182 0.15
183 0.14
184 0.14
185 0.15
186 0.12
187 0.15
188 0.15
189 0.16
190 0.16