Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MFF8

Protein Details
Accession T0MFF8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
91-122VVQRKTGESKTRKPRRARKDERKKSYARFGTVBasic
NLS Segment(s)
PositionSequence
97-134GESKTRKPRRARKDERKKSYARFGTVKRAMKKAERKNK
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MSSSNCDLEILKTTTNILLNRQELNLKIHHKESPVPPKTVITEKLSKLFQTSKDNIVLYDIFNVQGTHESVGKVNIYNNKSDLKNVEKDYVVQRKTGESKTRKPRRARKDERKKSYARFGTVKRAMKKAERKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.24
4 0.22
5 0.26
6 0.27
7 0.29
8 0.29
9 0.29
10 0.26
11 0.28
12 0.3
13 0.29
14 0.3
15 0.31
16 0.32
17 0.32
18 0.36
19 0.42
20 0.47
21 0.46
22 0.45
23 0.44
24 0.43
25 0.44
26 0.43
27 0.38
28 0.32
29 0.34
30 0.33
31 0.36
32 0.35
33 0.32
34 0.3
35 0.3
36 0.29
37 0.3
38 0.31
39 0.3
40 0.32
41 0.32
42 0.28
43 0.27
44 0.22
45 0.15
46 0.14
47 0.11
48 0.08
49 0.09
50 0.09
51 0.07
52 0.08
53 0.08
54 0.07
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.08
61 0.11
62 0.16
63 0.17
64 0.18
65 0.19
66 0.22
67 0.22
68 0.23
69 0.24
70 0.23
71 0.28
72 0.29
73 0.3
74 0.26
75 0.28
76 0.35
77 0.39
78 0.35
79 0.31
80 0.29
81 0.32
82 0.37
83 0.41
84 0.43
85 0.42
86 0.51
87 0.61
88 0.71
89 0.74
90 0.8
91 0.84
92 0.85
93 0.89
94 0.91
95 0.91
96 0.92
97 0.94
98 0.94
99 0.92
100 0.89
101 0.85
102 0.84
103 0.8
104 0.75
105 0.72
106 0.67
107 0.69
108 0.7
109 0.71
110 0.66
111 0.65
112 0.64
113 0.66
114 0.72