Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0MKW2

Protein Details
Accession T0MKW2    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
204-229REYIHFLKTKGYKCKKKNLTKMLGDIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 10.5, nucl 6, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039907  NOB1  
IPR036283  NOB1_Zf-like_sf  
IPR014881  NOB1_Zn-bd  
IPR033411  Ribonuclease_PIN  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004518  F:nuclease activity  
Pfam View protein in Pfam  
PF08772  NOB1_Zn_bind  
PF17146  PIN_6  
Amino Acid Sequences MIGIVDTCYFLKRGPFNQSIKKLFVSSLVVKELKNEESKEYFNLHRYMIEIREPLDKYIEFVQDFLSKKILNLSYTDIVVVALTIEINEIYSSTWIDSTNINNIEEVVCLTMDNGIKQCLRYLNLYDDLTFSSKIYKLRCFGCFSMYEEKLDFCKKCGLNTLTRVSVVQNENNNGTILLKKNYKFKPKVLIDKKGVELKSIDQREYIHFLKTKGYKCKKKNLTKMLGDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.5
4 0.59
5 0.67
6 0.65
7 0.62
8 0.59
9 0.52
10 0.44
11 0.39
12 0.36
13 0.31
14 0.29
15 0.31
16 0.3
17 0.29
18 0.32
19 0.33
20 0.31
21 0.31
22 0.3
23 0.3
24 0.32
25 0.34
26 0.33
27 0.34
28 0.33
29 0.32
30 0.33
31 0.28
32 0.25
33 0.25
34 0.25
35 0.23
36 0.23
37 0.2
38 0.19
39 0.25
40 0.25
41 0.24
42 0.24
43 0.22
44 0.2
45 0.23
46 0.25
47 0.19
48 0.18
49 0.2
50 0.22
51 0.24
52 0.22
53 0.21
54 0.18
55 0.18
56 0.23
57 0.23
58 0.18
59 0.19
60 0.22
61 0.2
62 0.2
63 0.2
64 0.14
65 0.12
66 0.11
67 0.09
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.07
84 0.08
85 0.09
86 0.13
87 0.14
88 0.14
89 0.14
90 0.14
91 0.13
92 0.12
93 0.11
94 0.06
95 0.04
96 0.04
97 0.04
98 0.07
99 0.06
100 0.07
101 0.07
102 0.09
103 0.09
104 0.09
105 0.11
106 0.1
107 0.12
108 0.13
109 0.14
110 0.16
111 0.19
112 0.19
113 0.18
114 0.16
115 0.16
116 0.16
117 0.14
118 0.11
119 0.1
120 0.12
121 0.15
122 0.18
123 0.2
124 0.22
125 0.26
126 0.28
127 0.31
128 0.29
129 0.29
130 0.27
131 0.28
132 0.32
133 0.29
134 0.28
135 0.23
136 0.24
137 0.24
138 0.28
139 0.24
140 0.18
141 0.25
142 0.25
143 0.26
144 0.33
145 0.34
146 0.35
147 0.41
148 0.43
149 0.36
150 0.36
151 0.35
152 0.27
153 0.3
154 0.27
155 0.26
156 0.26
157 0.27
158 0.28
159 0.28
160 0.27
161 0.21
162 0.19
163 0.18
164 0.17
165 0.19
166 0.24
167 0.26
168 0.35
169 0.43
170 0.53
171 0.54
172 0.56
173 0.62
174 0.65
175 0.73
176 0.73
177 0.74
178 0.7
179 0.7
180 0.69
181 0.66
182 0.57
183 0.48
184 0.42
185 0.38
186 0.42
187 0.4
188 0.36
189 0.31
190 0.32
191 0.35
192 0.39
193 0.35
194 0.31
195 0.31
196 0.31
197 0.38
198 0.44
199 0.47
200 0.52
201 0.62
202 0.66
203 0.71
204 0.82
205 0.84
206 0.87
207 0.9
208 0.9
209 0.89