Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0KWA3

Protein Details
Accession T0KWA3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-87NENTNKYKNSNKYRNTNKYRNSENTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 13.833, cyto 10, cyto_pero 5.999
Family & Domain DBs
Amino Acid Sequences MTKTNCTYDQALEADEKANGNIDEAISIIQNEVYVGNGQAVASAPDCDYNCDYENYSGNKYNNENTNKYKNSNKYRNTNKYRNSENTNKYNSGNSNSENNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.11
5 0.13
6 0.11
7 0.11
8 0.11
9 0.1
10 0.09
11 0.08
12 0.09
13 0.06
14 0.06
15 0.05
16 0.05
17 0.04
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.05
32 0.08
33 0.08
34 0.1
35 0.11
36 0.12
37 0.13
38 0.13
39 0.14
40 0.13
41 0.17
42 0.17
43 0.19
44 0.21
45 0.21
46 0.23
47 0.24
48 0.27
49 0.31
50 0.34
51 0.37
52 0.38
53 0.46
54 0.46
55 0.48
56 0.52
57 0.54
58 0.6
59 0.65
60 0.67
61 0.68
62 0.76
63 0.83
64 0.84
65 0.84
66 0.82
67 0.8
68 0.81
69 0.79
70 0.76
71 0.75
72 0.74
73 0.73
74 0.71
75 0.66
76 0.59
77 0.58
78 0.53
79 0.5
80 0.46
81 0.4
82 0.41