Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MCQ2

Protein Details
Accession T0MCQ2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-31HFLLCKKYGFKKTNKIRSHSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Gene Ontology GO:0003964  F:RNA-directed DNA polymerase activity  
Amino Acid Sequences MKKHNEIVRCIHFLLCKKYGFKKTNKIRSHSVQEVMSNDNAEIRVDTSVLTDIKFCHNKPDILVIDKKNKEILNVEIGITNQDLLTIFENEILRKYDLLANELGQIYKSRTKIIPYYHRKYIKELEIQPNLEAYMQSIVLKKTGMTLENLEAKLKINETKKPRDNQSEEYEYEIVLNNSKIENT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.42
4 0.43
5 0.51
6 0.58
7 0.61
8 0.64
9 0.67
10 0.73
11 0.79
12 0.82
13 0.78
14 0.76
15 0.76
16 0.76
17 0.7
18 0.64
19 0.55
20 0.5
21 0.47
22 0.41
23 0.34
24 0.25
25 0.2
26 0.17
27 0.15
28 0.13
29 0.11
30 0.09
31 0.08
32 0.08
33 0.08
34 0.07
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.18
41 0.22
42 0.21
43 0.26
44 0.29
45 0.3
46 0.3
47 0.37
48 0.31
49 0.31
50 0.37
51 0.33
52 0.4
53 0.4
54 0.4
55 0.36
56 0.35
57 0.32
58 0.28
59 0.26
60 0.21
61 0.21
62 0.2
63 0.16
64 0.16
65 0.15
66 0.13
67 0.1
68 0.06
69 0.05
70 0.05
71 0.05
72 0.07
73 0.07
74 0.07
75 0.09
76 0.1
77 0.1
78 0.11
79 0.12
80 0.11
81 0.1
82 0.11
83 0.11
84 0.11
85 0.12
86 0.12
87 0.1
88 0.12
89 0.12
90 0.11
91 0.09
92 0.09
93 0.1
94 0.14
95 0.15
96 0.16
97 0.17
98 0.2
99 0.24
100 0.32
101 0.4
102 0.44
103 0.5
104 0.56
105 0.61
106 0.6
107 0.6
108 0.59
109 0.55
110 0.54
111 0.55
112 0.55
113 0.53
114 0.53
115 0.47
116 0.41
117 0.35
118 0.27
119 0.2
120 0.12
121 0.08
122 0.08
123 0.09
124 0.11
125 0.11
126 0.11
127 0.11
128 0.1
129 0.12
130 0.14
131 0.14
132 0.14
133 0.17
134 0.2
135 0.26
136 0.26
137 0.24
138 0.22
139 0.23
140 0.22
141 0.22
142 0.25
143 0.24
144 0.32
145 0.39
146 0.49
147 0.56
148 0.62
149 0.69
150 0.73
151 0.74
152 0.73
153 0.74
154 0.7
155 0.62
156 0.6
157 0.51
158 0.4
159 0.35
160 0.3
161 0.22
162 0.18
163 0.18
164 0.14