Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L833

Protein Details
Accession T0L833   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-50DSLLSKEKTNQERKIRKAKYKEEIERLIHydrophilic
NLS Segment(s)
PositionSequence
35-42RKIRKAKY
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036279  5-3_exonuclease_C_sf  
IPR008918  HhH2  
IPR029060  PIN-like_dom_sf  
IPR006086  XPG-I_dom  
IPR006084  XPG/Rad2  
IPR019974  XPG_CS  
IPR006085  XPG_DNA_repair_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0035312  F:5'-3' DNA exonuclease activity  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF00867  XPG_I  
PF00752  XPG_N  
PROSITE View protein in PROSITE  
PS00842  XPG_2  
CDD cd09901  H3TH_FEN1-like  
Amino Acid Sequences MFERKIKLLIDNNIVPVVVFDGDSLLSKEKTNQERKIRKAKYKEEIERLIAKKFYNKAKEIMKRCISVSRKIVYDITKLLKKLNIEYIIAPYEADAQLYFLEEIKYIDFILTEDSDLIPYGCKNILFKFDNLYVDHYTIDCLLKAKDNIFKEYIQDICILSGCDYADSIPGIGVLTAHKLISKFKTIEKVVEFVKYRKKVPSNYMESFNLAKITFNHHIVYNPNSKKRQNINPIMEKYDFLGTLDEVDYSFEQENLLYFNKQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.22
4 0.17
5 0.11
6 0.08
7 0.07
8 0.07
9 0.08
10 0.09
11 0.1
12 0.12
13 0.12
14 0.13
15 0.19
16 0.27
17 0.37
18 0.45
19 0.53
20 0.61
21 0.7
22 0.78
23 0.83
24 0.84
25 0.84
26 0.85
27 0.85
28 0.84
29 0.85
30 0.85
31 0.82
32 0.78
33 0.73
34 0.71
35 0.63
36 0.57
37 0.49
38 0.42
39 0.4
40 0.42
41 0.46
42 0.45
43 0.45
44 0.47
45 0.54
46 0.62
47 0.62
48 0.65
49 0.61
50 0.55
51 0.54
52 0.57
53 0.51
54 0.5
55 0.5
56 0.43
57 0.39
58 0.39
59 0.42
60 0.35
61 0.34
62 0.31
63 0.3
64 0.3
65 0.3
66 0.3
67 0.29
68 0.27
69 0.27
70 0.3
71 0.26
72 0.24
73 0.24
74 0.25
75 0.23
76 0.22
77 0.18
78 0.12
79 0.12
80 0.11
81 0.1
82 0.07
83 0.07
84 0.07
85 0.08
86 0.08
87 0.06
88 0.06
89 0.06
90 0.07
91 0.06
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.05
106 0.04
107 0.06
108 0.06
109 0.06
110 0.07
111 0.09
112 0.15
113 0.16
114 0.17
115 0.18
116 0.2
117 0.21
118 0.21
119 0.23
120 0.18
121 0.17
122 0.17
123 0.13
124 0.12
125 0.11
126 0.1
127 0.07
128 0.07
129 0.07
130 0.09
131 0.1
132 0.12
133 0.17
134 0.19
135 0.21
136 0.23
137 0.22
138 0.22
139 0.23
140 0.22
141 0.17
142 0.16
143 0.13
144 0.11
145 0.11
146 0.1
147 0.08
148 0.08
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.06
163 0.06
164 0.06
165 0.07
166 0.08
167 0.12
168 0.15
169 0.2
170 0.2
171 0.23
172 0.31
173 0.31
174 0.35
175 0.33
176 0.33
177 0.29
178 0.33
179 0.33
180 0.3
181 0.39
182 0.37
183 0.39
184 0.44
185 0.5
186 0.5
187 0.57
188 0.62
189 0.61
190 0.6
191 0.62
192 0.55
193 0.51
194 0.46
195 0.38
196 0.3
197 0.22
198 0.2
199 0.16
200 0.22
201 0.23
202 0.24
203 0.24
204 0.23
205 0.25
206 0.28
207 0.33
208 0.35
209 0.39
210 0.46
211 0.51
212 0.54
213 0.61
214 0.66
215 0.7
216 0.71
217 0.73
218 0.74
219 0.77
220 0.78
221 0.74
222 0.66
223 0.56
224 0.48
225 0.4
226 0.31
227 0.22
228 0.19
229 0.14
230 0.15
231 0.15
232 0.13
233 0.1
234 0.12
235 0.12
236 0.13
237 0.14
238 0.12
239 0.12
240 0.12
241 0.12
242 0.13
243 0.15