Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MN49

Protein Details
Accession T0MN49    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-39SEILHKKELEKSQQKKKVKVFRNGKFVIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14, nucl 12.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008250  ATPase_P-typ_transduc_dom_A_sf  
Pfam View protein in Pfam  
PF00122  E1-E2_ATPase  
Amino Acid Sequences MIFYSYIEEIWSEILHKKELEKSQQKKKVKVFRNGKFVIKNATEIYPGDFIYIEIGDNFPCDAIIKKGDVIADESFLTGESVPVCKSHQQNSIVYSGTSILKSSILEHNDNCYKIANIKAEEQFNNFYSNSNTNNKYNKKKIIPEGYAISDDNQNSVFTKQVTTIKTENYAIGLVIGTGFNTARGKILRDILNSQPVYVGFLHEAYMYIYYTIFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.22
5 0.29
6 0.36
7 0.45
8 0.51
9 0.58
10 0.67
11 0.76
12 0.8
13 0.81
14 0.84
15 0.84
16 0.83
17 0.84
18 0.84
19 0.82
20 0.84
21 0.79
22 0.76
23 0.7
24 0.63
25 0.6
26 0.5
27 0.45
28 0.37
29 0.34
30 0.28
31 0.25
32 0.25
33 0.19
34 0.17
35 0.15
36 0.13
37 0.11
38 0.11
39 0.11
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.05
47 0.05
48 0.06
49 0.06
50 0.08
51 0.1
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.14
58 0.12
59 0.12
60 0.11
61 0.11
62 0.09
63 0.09
64 0.09
65 0.06
66 0.06
67 0.05
68 0.06
69 0.06
70 0.07
71 0.08
72 0.13
73 0.16
74 0.21
75 0.27
76 0.29
77 0.31
78 0.32
79 0.33
80 0.28
81 0.25
82 0.2
83 0.15
84 0.13
85 0.11
86 0.09
87 0.07
88 0.07
89 0.07
90 0.09
91 0.12
92 0.14
93 0.15
94 0.15
95 0.2
96 0.22
97 0.22
98 0.2
99 0.16
100 0.14
101 0.15
102 0.18
103 0.17
104 0.16
105 0.2
106 0.22
107 0.24
108 0.25
109 0.25
110 0.24
111 0.21
112 0.22
113 0.18
114 0.16
115 0.16
116 0.19
117 0.21
118 0.24
119 0.26
120 0.29
121 0.38
122 0.45
123 0.51
124 0.55
125 0.59
126 0.6
127 0.63
128 0.67
129 0.68
130 0.62
131 0.57
132 0.53
133 0.47
134 0.42
135 0.35
136 0.28
137 0.22
138 0.19
139 0.17
140 0.14
141 0.13
142 0.12
143 0.12
144 0.13
145 0.1
146 0.11
147 0.14
148 0.19
149 0.2
150 0.24
151 0.25
152 0.26
153 0.28
154 0.28
155 0.24
156 0.2
157 0.19
158 0.14
159 0.12
160 0.1
161 0.07
162 0.06
163 0.06
164 0.04
165 0.05
166 0.05
167 0.08
168 0.09
169 0.09
170 0.12
171 0.14
172 0.17
173 0.2
174 0.27
175 0.29
176 0.31
177 0.36
178 0.37
179 0.45
180 0.42
181 0.38
182 0.33
183 0.29
184 0.28
185 0.23
186 0.21
187 0.13
188 0.13
189 0.14
190 0.12
191 0.12
192 0.11
193 0.12
194 0.1
195 0.09