Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0L411

Protein Details
Accession T0L411    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-46KCFYKLKSPTIQSKKKKRYSDTLKDPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR031509  Mei5-like  
Pfam View protein in Pfam  
PF17021  Mei5_like  
Amino Acid Sequences MYFIKVENEENYDKIIVDSKCFYKLKSPTIQSKKKKRYSDTLKDPLYIEQDIFRKLNMIKQFREKNGDIYELIEKYKNIIEECIIIMDKEYDIKPSEIFKLFNLEKYGFKLDDFER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.19
4 0.2
5 0.23
6 0.22
7 0.29
8 0.3
9 0.3
10 0.32
11 0.37
12 0.42
13 0.46
14 0.51
15 0.54
16 0.64
17 0.73
18 0.74
19 0.8
20 0.83
21 0.83
22 0.86
23 0.81
24 0.81
25 0.82
26 0.82
27 0.81
28 0.79
29 0.72
30 0.65
31 0.59
32 0.5
33 0.43
34 0.32
35 0.22
36 0.17
37 0.17
38 0.18
39 0.17
40 0.15
41 0.14
42 0.14
43 0.19
44 0.23
45 0.25
46 0.25
47 0.34
48 0.39
49 0.38
50 0.45
51 0.4
52 0.38
53 0.35
54 0.35
55 0.27
56 0.24
57 0.24
58 0.19
59 0.19
60 0.15
61 0.13
62 0.13
63 0.15
64 0.15
65 0.13
66 0.13
67 0.13
68 0.13
69 0.13
70 0.13
71 0.11
72 0.09
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.11
79 0.13
80 0.14
81 0.15
82 0.17
83 0.22
84 0.22
85 0.23
86 0.21
87 0.28
88 0.29
89 0.32
90 0.34
91 0.31
92 0.3
93 0.34
94 0.38
95 0.3
96 0.29