Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0MFI5

Protein Details
Accession T0MFI5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-45DERKESFKSRINIKKRKKKWTEVKKKDEQRKIFTVBasic
NLS Segment(s)
PositionSequence
17-37FKSRINIKKRKKKWTEVKKKD
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MDLNFTKSELDERKESFKSRINIKKRKKKWTEVKKKDEQRKIFTVSDELLQKVEKEVKKAKLLTVFSLGSRLNLTLSVAKNILRYFVERGDLFVIHRSNQTVIYGQPIVETKEEITNNNETISENISLQEKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.45
4 0.46
5 0.48
6 0.52
7 0.59
8 0.63
9 0.7
10 0.78
11 0.83
12 0.85
13 0.9
14 0.89
15 0.89
16 0.9
17 0.91
18 0.91
19 0.91
20 0.91
21 0.91
22 0.91
23 0.91
24 0.9
25 0.85
26 0.81
27 0.76
28 0.72
29 0.63
30 0.54
31 0.46
32 0.37
33 0.33
34 0.27
35 0.21
36 0.16
37 0.15
38 0.14
39 0.13
40 0.19
41 0.17
42 0.21
43 0.27
44 0.31
45 0.36
46 0.37
47 0.37
48 0.36
49 0.36
50 0.32
51 0.3
52 0.26
53 0.2
54 0.22
55 0.19
56 0.13
57 0.13
58 0.11
59 0.08
60 0.07
61 0.08
62 0.1
63 0.11
64 0.12
65 0.12
66 0.12
67 0.14
68 0.14
69 0.15
70 0.12
71 0.13
72 0.14
73 0.15
74 0.18
75 0.16
76 0.17
77 0.17
78 0.17
79 0.15
80 0.18
81 0.18
82 0.15
83 0.17
84 0.17
85 0.16
86 0.16
87 0.17
88 0.14
89 0.13
90 0.16
91 0.16
92 0.14
93 0.15
94 0.15
95 0.16
96 0.16
97 0.16
98 0.13
99 0.19
100 0.21
101 0.21
102 0.23
103 0.25
104 0.25
105 0.25
106 0.24
107 0.18
108 0.19
109 0.2
110 0.18
111 0.14
112 0.15
113 0.16